PRGDB00049149 (At3g05360)

From PRG Wiki
Jump to: navigation, search
At3g05360
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21436472 (AY117362)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative disease resistance protein (At3g05360) mRNA, complete cds.

DNA Sequence

ATGATTCCAAGCCAATCTAATTCCTTTTCTGGTAGTGTTATTACCTTGTATTTCTTCCTCCTGGGTTCCCTTGTTCTACGCACTCTTGCTTCTTCTAGGCTTCACTATTGCCGCCATGACCAAAGGGATGCTCTTCTCGAGTTCAAACACGAGTTTCCGGTAAGTGAATCGAAGCCAAGTCCATCGTTGAGTTCATGGAACAAGACTAGTGATTGCTGTTTTTGGGAGGGTGTCACGTGCGATGATGAATCTGGCGAGGTGGTTTCACTTGACCTTAGTTATGTCCTTCTCAACAACTCTTTGAAACCAACTAGTGGTCTTTTCAAACTCCAACAACTCCAGAACCTGACTCTCAGTGATTGCCATCTCTATGGAGAGGTTACTTCTTCACTAGGAAACCTTTCTCGTCTCACGCATCTTGACCTTTCGAGTAATCAGCTGACAGGTGAAGTTCTGGCTTCGGTCAGTAAGCTAAACCAACTTAGAGACCTTTTACTTTCCGAAAACAGTTTTAGTGGTAACATTCCTACTTCATTTACCAATTTAACGAAGCTTTCTAGTTTAGACATCTCTAGCAATCAGTTCACATTGGAAAATTTCTCTTTCATACTACCAAATTTAACCAGCTTGTCCTCCTTAAACGTTGCCTCTAATCACTTTAAATCCACGCTTCCATCTGATATGAGTGGACTCCACAACTTGAAATATTTTGATGTGCGTGAGAATTCATTTGTCGGGACTTTTCCTACATCCTTATTCACGATTCCTTCGTTACAAATTGTTTATTTGGAAGGAAACCAGTTCATGGGACCTATAAAGTTTGGGAATATATCTTCATCTTCTAGGCTTTGGGATCTAAACCTTGCTGATAACAAATTCGATGGGCCAATCCCTGAATATATATCTGAAATTCACAGTCTCATAGTACTAGATCTTAGCCACAACAACTTAGTTGGGCCAATCCCCACTTCTATATCAAAGTTGGTCAACCTTCAGCATCTTAGTCTTTCAAACAATACCTTGGAAGGCGAAGTGCCAGGTTGCTTATGGGGATTGATGACAGTGACACTTTCCCACAATTCTTTCAACAGTTTTGGAAAGTCATCATCCGGAGCTTTGGATGGAGAATCAATGCAGGAGTTGGATCTTGGTTCGAATTCACTTGGAGGACCTTTTCCCCATTGGATCTGCAAGCAAAGGTTCTTAAAGTACTTAGACTTGTCCAACAATCTCTTCAACGGCTCAATTCCTCCTTGTTTGAAAAATTCCACTTATTGGCTTAAAGGGCTAGTTCTGCGTAACAACAGCTTCAGCGGATTTCTCCCAGACGTATTTGTCAATGCTAGCATGTTATTATCACTTGACGTTAGCTACAACCGGTTGGAGGGAAAACTTCCAAAATCCCTGATCAATTGCACTGGTATGGAACTTCTGAATGTGGGAAGCAACATAATCAAGGACACTTTTCCATCCTGGTTGGTTTCTTTGCCATCATTACGTGTCCTCATCCTCAGATCTAATGCATTCTATGGGTCGTTATATTATGACCACATATCTTTTGGGTTTCAACATTTGAGACTCATTGATATATCACAGAATGGCTTCAGTGGAACTTTGTCACCTTTATATTTCTCCAATTGGCGTGAGATGGTGACATCTGTCTTAGAAGAAAACGGCTCTAATATAGGTACAGAGGATTGGTACATGGGCGAGAAAGGGCCCGAGTTCAGCCATAGTAATTCGATGACTATGATATATAAAGGAGTAGAAACGGACTTCTTGCGGATCCCATATTTCTTCAGAGCCATTGACTTTTCTGGAAACAGATTTTTTGGGAATATACCTGAATCCGTTGGTTTGTTGAAGGAATTGCGTCTTCTCAATTTGTCAGGTAACTCATTCACAAGCAATATCCCTCAGTCATTGGCAAATTTGACAAATCTTGAGACATTGGACCTATCCCGGAATCAGCTATCAGGTCACATCCCTCGAGATCTTGGTAGCCTCTCTTTTCTGTCGACCATGAATTTCTCCCATAACCTTCTCGAAGGTCCAGTTCCACTAGGCACTCAGTTTCAAAGCCAACATTGTTCTACATTCATGGACAACCTCAGACTCTACGGTCTTGAGAAAATCTGTGGAAAAGCTCATGCCCCGAGTTCTACACCACTAGAATCCGAGGAATTTTCGGAACCAGAAGAACAAGTGATTAACTGGATAGCAGCGGCAATAGCCTACGGACCTGGTGTGTTTTGTGGATTAGTTATTGGACATATCTTCTTTACTGCACACAAACACGAGTGGTTCATGGAAAAATTCCATCGAAACAAGCGCAGAGTAGTCACCACAAGTGCTCGTTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MIPSQSNSFSGSVITLYFFLLGSLVLRTLASSRLHYCRHDQRDALLEFKHEFPVSESKPSPSLSSWNKTSDCCFWEGVTCDDESGEVVSLDLSYVLLNNSLKPTSGLFKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLNQLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLNVASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQFMGPIKFGNISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGALDGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTYWLKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQNGFSGTLSPLYFSNWREMVTSVLEENGSNIGTEDWYMGEKGPEFSHSNSMTMIYKGVETDFLRIPYFFRAIDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGTQFQSQHCSTFMDNLRLYGLEKICGKAHAPSSTPLESEEFSEPEEQVINWIAAAIAYGPGVFCGLVIGHIFFTAHKHEWFMEKFHRNKRRVVTTSAR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-770 PTHR24420,FAMILY NOT NAMED

MIPSQSNSFSGSVITLYFFLLGSLVLRTLASSRLHYCRHDQRDALLEFKHEFPVSESKPSPSLSSWNKTSDCCFWEGVTCDDESGEVVSLDLSYVLLNNSLKPTSGLFKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLNQLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLNVASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQFMGPIKFGNISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGALDGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTYWLKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQNGFSGTLSPLYFSNWREMVTSVLEENGSNIGTEDWYMGEKGPEFSHSNSMTMIYKGVETDFLRIPYFFRAIDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGTQFQSQHCSTFMDNLRLYGLEKICGKAHAPSSTPLESEEFSEPEEQVINWIAAAIAYGPGVFCGLVIGHIFFTAHKHEWFM

HMMPanther: PTHR24420:SF913
1-770 PTHR24420:SF913

MIPSQSNSFSGSVITLYFFLLGSLVLRTLASSRLHYCRHDQRDALLEFKHEFPVSESKPSPSLSSWNKTSDCCFWEGVTCDDESGEVVSLDLSYVLLNNSLKPTSGLFKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLNQLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLNVASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQFMGPIKFGNISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGALDGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTYWLKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQNGFSGTLSPLYFSNWREMVTSVLEENGSNIGTEDWYMGEKGPEFSHSNSMTMIYKGVETDFLRIPYFFRAIDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGTQFQSQHCSTFMDNLRLYGLEKICGKAHAPSSTPLESEEFSEPEEQVINWIAAAIAYGPGVFCGLVIGHIFFTAHKHEWFM

Gene3D: G3DSA:3.80.10.10
37-276 G3DSA:3.80.10.10

CRHDQRDALLEFKHEFPVSESKPSPSLSSWNKTSDCCFWEGVTCDDESGEVVSLDLSYVLLNNSLKPTSGLFKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLNQLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLNVASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQFMGPIKFGN

HMMPfam: PF08263
IPR013210
39-81 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HDQRDALLEFKHEFPVSESKPSPSLSSWNKTSDCCFWEGVTCD

superfamily: SSF52047
89-413 SSF52047,LRR

SLDLSYVLLNNSLKPTSGLFKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLNQLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLNVASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQFMGPIKFGNISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGALDGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFN

HMMPfam: PF13516
134-154 LRR_6,Leucine Rich repeat

LSRLTHLDLSSNQLTGEVLAS

ProfileScan: PS51450
IPR001611
136-159 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTHLDLSSNQLTGEVLASVSKLN

FPrintScan: PR00019
137-150 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSSNQLTGE

ProfileScan: PS51450
IPR001611
160-183 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRDLLLSENSFSGNIPTSFTNLT

HMMPfam: PF13516
182-199 LRR_6,Leucine Rich repeat

LTKLSSLDISSNQFTLEN

ProfileScan: PS51450
IPR001611
184-204 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLSSLDISSNQFTLENFSFIL

ProfileScan: PS51450
IPR001611
209-230 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSSLNVASNHFKSTLPSDMSG

Gene3D: G3DSA:3.80.10.10
277-422 G3DSA:3.80.10.10

ISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGALDGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKN

HMMPfam: PF13855
282-341 LRR_8,Leucine rich repeat

RLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVNLQHLSLSNNTL

ProfileScan: PS51450
IPR001611
306-328 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIVLDLSHNNLVGPIPTSISKL

ProfileScan: PS51450
IPR001611
330-353 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQHLSLSNNTLEGEVPGCLWGLM

superfamily: SSF52058
341-703 SSF52058,LRR

LEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGALDGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTYWLKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQNGFSGTLSPLYFSNWREMVTSVLEENGSNIGTEDWYMGEKGPEFSHSNSMTMIYKGVETDFLRIPYFFRAIDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGTQFQSQHCSTFMDN

ProfileScan: PS51450
IPR001611
401-423 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLKYLDLSNNLFNGSIPPCLKNS

HMMPfam: PF00560
IPR001611
402-422 LRR_1
Leucine-rich repeat

LKYLDLSNNLFNGSIPPCLKN

Gene3D: G3DSA:3.80.10.10
427-552 G3DSA:3.80.10.10

LKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQNGFSGTLSPLYFSNWREMVT

ProfileScan: PS51450
IPR001611
450-473 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLLSLDVSYNRLEGKLPKSLINCT

HMMPfam: PF13855
453-508 LRR_8,Leucine rich repeat

SLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTFPSWLVSLPSLRVLILRSNA

ProfileScan: PS51450
IPR001611
524-546 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRLIDISQNGFSGTLSPLYFSN

Gene3D: G3DSA:3.80.10.10
603-703 G3DSA:3.80.10.10

IDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGTQFQSQHCSTFMDN

HMMPfam: PF12799
623-659 LRR_4,Leucine Rich repeats (2 copies)

ELRLLNLSGNSFTSNIPQSLANLTNLETLDLSRNQLS

ProfileScan: PS51450
IPR001611
623-646 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRLLNLSGNSFTSNIPQSLANLT

FPrintScan: PR00019
645-658 LEURICHRPT,Leucine-rich repeat signature

LTNLETLDLSRNQL

ProfileScan: PS51450
IPR001611
647-670 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLETLDLSRNQLSGHIPRDLGSLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox