PRGDB00049156 (At4g13820)

From PRG Wiki
Jump to: navigation, search
At4g13820
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19347838 (AY080729)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative disease resistance protein (At4g13820) mRNA, complete cds.

DNA Sequence

ATGAAGATGACAATATGGAGCTTGTGTTTAATCTTGTCCCTTTCTAATTCAAAACTGGTTTTGGCTTCTCATGTTAAGCACTTATGTCGTCAAGACCAGAAGAATGCTCTTTTGGAGTTTAAGAACGAGTTTTATGTCCATGAGTTCAACTCCAATGGGATTGTTGGTGTTAAGAAGACAGAGAAGTGGAGGAACAACACCGATTGCTGTTCTTGGGATGGTATCTCTTGTGATCCTAAAACGGGTAAGGTGGTAGAGTTAGACCTCATGAACAGTTTTCTTAATGGTCCTTTGAGATATGATAGTAGCTTGTTTAGACTACAACATCTTCATAATCTGGATCTTGGCTCGAATAATTTTTCGGGTATTCTACCGGATTCCATAGGCAGCCTCAAATATTTGAGGGTTTTGAGTCTTGGTGATTGTAATCTCTTTGGAAAGATTCCTTCTTCACTTGGAAATCTTACTTATCTCACTAATCTTGATCTTTCTGTTAATGATTTCACCGGGGAGCTACCGGATTCGATGGGACATTTAAACAAGCTAACAGAGTTGCATCTTGGATCGGCCAAGCTCAGTGGGAACTTTCCTAGTATGCTACTCAATTTGAGCGAGCTTACGTTGATCGACCTTGGTTCTAACCAGTTCGGAGGTATGCTCCCATCTAATATGAGTAGCCTCTCTAAATTGGTGTATTTTGGGATTGATAGAAATTCATTTTCCGGATCTATCCCATCGTCTCTCTTCATGCTACCTTCATTGACCTCTCTTGTTTTGGGAAGAAACGACTTCAACGGTCCTCTTGACTTTGGTAATATCTCTTCACCATCTAATCTTGGAGTTTTGTCCCTTCTAGAAAACAATTTCAATGGGCCAATCCCGGAGTCTATATCGAAACTAGTTGGTCTCTTTTATCTTGACCTCTCTTTATGGAACACAAAGAGAGGCATGGTCGATTTCAACACTTTCTTGCATCTCAAGTCACTTACGTTCCTTGACCTCTCTTATATTAATACAAGAAGCATGGTTGACATAAGTATATTCTCACCTCTCTTGTCACTTGGTTATTTGGATCTTTCCGGGATTAATTTGAAGATCAGTTCAACTCTAAGTCTTCCCTCACCCATGGGCACCTTGATTTTATCATCTTGCAATATTCCTGAGTTCCCCAATTTTCTAGAAAACCAAACCACTTTGTATTATTTAGACATCTCTGCCAATAAAATTGGAGGCCAAGTACCACAATGGTTGTGGAGTCTACCGGAGTTGCAGTATGTTAACATTTCTCAAAATTCTTTCAGTGGCTTTGAAGGACCAGCAGATGTTATTCAAAGATGTGGAGAATTACTTATGCTTGACATAAGTTCAAACACATTCCAAGATCCGTTTCCTTTGTTACCAAACTCGACAACGATCTTTTTAGGCTCTGATAATCGGTTTTCGGGAGAGATTCCTAAGACTATATGCAAATTGGTTTCTCTTGATACACTTGTTTTATCCAACAACAACTTCAACGGCTCCATTCCTCGGTGTTTCGAGAAGTTTAATACTACTCTTTCGGTTTTGCATCTTCGGAATAACAACTTATCCGGTGAGTTTCCAGAGGAATCTATCAGTGATCACTTGAGATCACTTGACGTTGGTCGCAACCGGTTATCAGGAGAACTTCCCAAGTCTTTGATCAACTGCACTCGTCTCGAGTTTCTGAACGTGGAAGACAACATAATCAATGACAAGTTTCCATTCTGGTTGAGAATGTTGCCCAAACTTCAGATTTTTGTCCTTCGTTCTAACGAGTTTCATGGTCCAATATCTTCTCTTGGAGATTCTTTGAGCTTCCCCAAGCTGCGAATCTTTGACATTTCGGAAAACCGCTTCAATGGAGTCCTTCGATCAGATTTCTTTGCGGGTTGGAGTGCAATGTCATCAGCCGTAGACATCGTAGATATTATGCCGAGTAGGTATGCTGGACGTGACTCAGGAAACTATTATAACTCAGTGACTATGACGGTCAAAGGATCGATAATAGAGTTGGTTGGGAGTGTTTTCACGATTTACAAAACCATCGATGTCTCCGGAAACAGATTCGAAGGACGTATTCCCGAGTCAATCGGTTTACTTAAAGAACTGATTGTGCTCAATATGTCAAACAACGGTTGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKMTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGGMLPSNMSSLSKLVYFGIDRNSFSGSIPSSLFMLPSLTSLVLGRNDFNGPLDFGNISSPSNLGVLSLLENNFNGPIPESISKLVGLFYLDLSLWNTKRGMVDFNTFLHLKSLTFLDLSYINTRSMVDISIFSPLLSLGYLDLSGINLKISSTLSLPSPMGTLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNG


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-719 PTHR24420,FAMILY NOT NAMED

MKMTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGGMLPSNMSSLSKLVYFGIDRNSFSGSIPSSLFMLPSLTSLVLGRNDFNGPLDFGNISSPSNLGVLSLLENNFNGPIPESISKLVGLFYLDLSLWNTKRGMVDFNTFLHLKSLTFLDLSYINTRSMVDISIFSPLLSLGYLDLSGINLKISSTLSLPSPMGTLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNG

HMMPanther: PTHR24420:SF913
1-719 PTHR24420:SF913

MKMTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGGMLPSNMSSLSKLVYFGIDRNSFSGSIPSSLFMLPSLTSLVLGRNDFNGPLDFGNISSPSNLGVLSLLENNFNGPIPESISKLVGLFYLDLSLWNTKRGMVDFNTFLHLKSLTFLDLSYINTRSMVDISIFSPLLSLGYLDLSGINLKISSTLSLPSPMGTLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNNG

Gene3D: G3DSA:3.80.10.10
29-302 G3DSA:3.80.10.10

CRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGGMLPSNMSSLSKLVYFGIDRNSFSGSIPSSLFMLPSLTSLVLGRNDFNGPLDFGNISSPSNLGVLSLLENNFNGPIPESISKLVG

HMMPfam: PF08263
IPR013210
31-78 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCD

superfamily: SSF52047
112-434 SSF52047,LRR

NLDLGSNNFSGILPDSIGSLKYLRVLSLGDCNLFGKIPSSLGNLTYLTNLDLSVNDFTGELPDSMGHLNKLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGGMLPSNMSSLSKLVYFGIDRNSFSGSIPSSLFMLPSLTSLVLGRNDFNGPLDFGNISSPSNLGVLSLLENNFNGPIPESISKLVGLFYLDLSLWNTKRGMVDFNTFLHLKSLTFLDLSYINTRSMVDISIFSPLLSLGYLDLSGINLKISSTLSLPSPMGTLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFS

HMMPfam: PF00560
IPR001611
134-155 LRR_1
Leucine-rich repeat

LRVLSLGDCNLFGKIPSSLGNL

HMMPfam: PF13504
156-173 LRR_7,Leucine rich repeat

TYLTNLDLSVNDFTGELP

Gene3D: G3DSA:3.80.10.10
303-461 G3DSA:3.80.10.10

LFYLDLSLWNTKRGMVDFNTFLHLKSLTFLDLSYINTRSMVDISIFSPLLSLGYLDLSGINLKISSTLSLPSPMGTLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQD

HMMPfam: PF13855
378-432 LRR_8,Leucine rich repeat

TLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNS

superfamily: SSF52058
378-718 SSF52058,LRR

TLILSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSSAVDIVDIMPSRYAGRDSGNYYNSVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMSNN

Gene3D: G3DSA:3.80.10.10
467-643 G3DSA:3.80.10.10

PNSTTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEESISDHLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPISSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMSS

HMMPfam: PF00560
IPR001611
519-538 LRR_1
Leucine-rich repeat

LSVLHLRNNNLSGEFPEESI

HMMPfam: PF00560
IPR001611
541-562 LRR_1
Leucine-rich repeat

HLRSLDVGRNRLSGELPKSLIN

Gene3D: G3DSA:3.80.10.10
689-718 G3DSA:3.80.10.10

IDVSGNRFEGRIPESIGLLKELIVLNMSNN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox