PRGDB00049187 (At2g15080)

From PRG Wiki
Jump to: navigation, search
At2g15080
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22136011 (AY128385)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative disease resistance protein (At2g15080) mRNA, complete cds.

DNA Sequence

ATGATGAAAGGCTATATTACTCTTTCTTTTCTTATCATTCTCATTTTTAATTTCCTTGACGAGTTTGCGGCTTCTACTAGACACTTGTGTGATCCTGATCAAAGTGATGCAATTCTCGAATTCAAGAACGAGTTTGAGACTTTGGAGGAATCTTGTTTTGACAGCAATATTCCTCTGAAGACGGAGTCATGGACGAATAACAGTGATTGTTGTTATTGGGATGGTATCAAATGTGATGCCAAGTTCGGGGATGTGATCGAGCTAGATCTTAGCTTTAGTTGCCTCCGTGGCCAGCTCAATTCCAATAGTAGTCTTTTTAGGCTTCCACAACTTCGTTTTCTAACCACTCTTGACCTTTCTAATAATGATTTTATTGGTCAAATCCCATCTTCACTTGAAACCCTCTCTAATCTCACCACTCTAGACCTTTCTAGAAATCATTTCAGTGGTAGAATTCCTTCTTCGATTGGAAACCTTTCTCATCTCATATTTGTTGACTTCTCTCATAACAATTTTAGTGGTCAAATCCCATCTTCACTTGGATATCTTTCGCATCTCACCTCTTTTAACCTTTCTTATAACAATTTTAGTGGTAGGGTTCCTTCTTCAATTGGAAATCTCTCTTATCTCACCACTTTGCGCCTCTCTCGTAATAGTTTTTTTGGTGAACTTCCATCTTCACTTGGAAGTCTTTTCCATCTCACCGATTTGATCCTCGATACTAACCATTTTGTTGGTAAAATTCCGTCTTCACTTGGAAATCTTTCGCATCTCACCTCTATCGACCTCCACAAAAATAATTTTGTTGGCGAAATACCATTTTCACTTGGAAATCTTTCTTGTCTCACCTCTTTTATCCTCTCTGATAACAACATTGTTGGTGAAATTCCATCTTCTTTTGGCAATTTGAACCAGTTGGACATCTTAAATGTTAAGTCCAATAAGCTTAGTGGCAGCTTCCCAATTGCACTACTAAATCTAAGAAAACTGTCAACATTATCTCTCTTTAACAATCGGTTAACCGGAACACTTACTTCTAACATGAGTTCACTCTCCAACTTGAAGTTGTTTGACGCAACGGAAAACCATTTCACGGGACCTCTCCCTTCTTCCCTTTTCAACATTCCCTCTTTGAAAACTATTACTTTGGAAAATAACCAACTTAACGGTAGTCTTGGGTTTGGGAATATATCCTCATACTCGAATTTAACTGTGTTACGCCTTGGGAATAACAACTTTAGAGGGCCAATCCATAGATCTATATCCAAATTAGTCAACCTTAAGGAACTTGACCTTTCAAACTACAACACCCAAGGGTTAGTTGACTTTACCATCTTCTCGCATCTCAAGTCTATCGAATACCTTAACCTCTCCCATTTGAACACCACTACTACGATTGACATGTACGAGATCTTATCAAGTTTCAAGTTATTGGATACACTAGATCTCTCAGGCAGCCATGTTTCTACTACAAACAAGAGTTCACTTTCTAATTCTTCATTGGTATTGATAAGTCAGTTGTACTTGTCGGGATGCGGTATCACCGAGTTTCCAAAGTTCCTAAGATCCCAAGAGCTTATGCTGACTCTAGACATTTCCAACAACAAGATCAAAGGTCAAGTGCCTGGATGGTTATGGATGCTCCCTGTTTTGAACTACGTGAATCTTTCCAACAACACTTTCATCGGTTTCGAAAGATCAACGAAACTTGGACTCACCTCTATCCAAGAACCACCAGCTATGAGGCAATTGTTTTGCTCCAACAACAATTTCACGGGAAACATTCCATCTTTCATATGTGAGTTGCCTTATCTCAGCACTCTCGATTTTTCTAACAACAAATTCAATGGTTCAATTCCTACTTGTATGGGAAATATTCAGTCTCCATATCTTCAAGCTCTAAATCTTCGACATAATCGTCTTAGTGGACTTCTTCCAGAGAATATATTTGAGAGTCTAATTTCTCTTGACGTCGGCCATAACCAACTAGTGGGAAAGCTTCCAAGATCGTTAAGTCATATCTCTTCCCTTGGACTTCTGAATGTGGAGAGCAACAAAATCAGTGATACGTTTCCTTTATGGTTGAGTTCTCTACAAGAGCTACAAGTTCTTGTCCTTCGCTCCAATGCATTTTATGGACCAATAGAGAAAACACAGTTTTCTAAGCTGCGAATCATTGACATATCCGGTAATCAATTCAATGGTACGTTGCCAGCAAATTTCTTTGTCAACTGGACTGCAATGTTTTCACTGGACGAAAATGAAGATCAATCTAACGGAGAGACCATGAGCAACATGTACATGAGTACAGATTATTTCTACTTTGATTCAATGGTTTTGATGAATAAAGGAGTAGAGATGGAGCTGGAACGTGTCCTAAAAGTCTTCACAGTGATTGACTTTTCGGGAAACAAATTTGAAGGAGAGATTCCAAAGTCCATTGGTTTATTGAAAGAGCTTCATGTTCTTAACTTATCAAACAATGCTTTAAGTGGCCACATCGCATCATCTATGGGGAACCTCATGGCACTTGAGTCACTGGACGTTTCCCAAAACAAGCTTTCAGGAGAAATTCCACAAGAGTTAGGGAAACTCACGTACCTTGCATACATGAACTTCTCTCATAACCAGCTGGTAGGTCTATTACCAGGAGGTACTCAATTTCAAACACAGAAGTGCTCTTCTTTCGAGGACAATCATGGCCTTTATGGCCCTTCGCTTGAGAAAATTTGTGATATCCATGGGAAAACACCGCAACAATCTGACATGGCGCCAGAGCCAGAAGAAGATGAAGAAGAGGTGATAAGTTGGATAGCAGCTGTTATAGGATTCATACTTGGTACTGCCTTGGGATTGACATTTGGATGCATATTGTTTTCCTACAAACCAGATTGGTTCAAGAATCCTTTCGTCCGAGACAAACGCAGAAACATAGGCACCATAACTCATTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MMKGYITLSFLIILIFNFLDEFAASTRHLCDPDQSDAILEFKNEFETLEESCFDSNIPLKTESWTNNSDCCYWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLVDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSSLVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTFIGFERSTKLGLTSIQEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLRHNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDENEDQSNGETMSNMYMSTDYFYFDSMVLMNKGVEMELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAYMNFSHNQLVGLLPGGTQFQTQKCSSFEDNHGLYGPSLEKICDIHGKTPQQSDMAPEPEEDEEEVISWIAAVIGFILGTALGLTFGCILFSYKPDWFKNPFVRDKRRNIGTITH


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-978 PTHR24420:SF473,SUBFAMILY NOT NAMED

MMKGYITLSFLIILIFNFLDEFAASTRHLCDPDQSDAILEFKNEFETLEESCFDSNIPLKTESWTNNSDCCYWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLVDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSSLVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTFIGFERSTKLGLTSIQEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLRHNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDENEDQSNGETMSNMYMSTDYFYFDSMVLMNKGVEMELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAYMNFSHNQLVGLLPGGTQFQTQKCSSFEDNHGLYGPSLEKICDIHGKTPQQSDMAPEPEEDEEEVISWIAAVIGFILGTALGLTFGCILFSYKPDWFKNPFVRDKRRNI

HMMPanther: PTHR24420
1-978 PTHR24420,FAMILY NOT NAMED

MMKGYITLSFLIILIFNFLDEFAASTRHLCDPDQSDAILEFKNEFETLEESCFDSNIPLKTESWTNNSDCCYWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLVDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSSLVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTFIGFERSTKLGLTSIQEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLRHNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDENEDQSNGETMSNMYMSTDYFYFDSMVLMNKGVEMELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAYMNFSHNQLVGLLPGGTQFQTQKCSSFEDNHGLYGPSLEKICDIHGKTPQQSDMAPEPEEDEEEVISWIAAVIGFILGTALGLTFGCILFSYKPDWFKNPFVRDKRRNI

superfamily: SSF52058
28-338 SSF52058,LRR

HLCDPDQSDAILEFKNEFETLEESCFDSNIPLKTESWTNNSDCCYWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNN

HMMPfam: PF08263
IPR013210
32-79 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQSDAILEFKNEFETLEESCFDSNIPLKTESWTNNSDCCYWDGIKCD

Gene3D: G3DSA:3.80.10.10
57-309 G3DSA:3.80.10.10

IPLKTESWTNNSDCCYWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPSSLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDIL

HMMPfam: PF13855
114-172 LRR_8,Leucine rich repeat

LTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNF

HMMPfam: PF13516
183-206 LRR_6,Leucine Rich repeat

LSHLTSFNLSYNNFSGRVPSSIGN

HMMPfam: PF00560
IPR001611
210-231 LRR_1
Leucine-rich repeat

LTTLRLSRNSFFGELPSSLGSL

superfamily: SSF52047
247-563 SSF52047,LRR

KIPSSLGNLSHLTSIDLHKNNFVGEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLVDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSSLVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTFIG

HMMPfam: PF00560
IPR001611
282-303 LRR_1
Leucine-rich repeat

LTSFILSDNNIVGEIPSSFGNL

Gene3D: G3DSA:3.80.10.10
310-561 G3DSA:3.80.10.10

NVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLVDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSSLVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTF

HMMPfam: PF13855
401-459 LRR_8,Leucine rich repeat

SNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGLVDFTIFSHLKSIEYLNLSH

HMMPfam: PF13855
505-559 LRR_8,Leucine rich repeat

SQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNN

Gene3D: G3DSA:3.80.10.10
573-637 G3DSA:3.80.10.10

TSIQEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLR

superfamily: SSF52058
578-911 SSF52058,LRR

PPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLRHNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDENEDQSNGETMSNMYMSTDYFYFDSMVLMNKGVEMELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAYMNFSHNQLVGLLPGGTQFQTQKCSSFEDNHGLYGPSLEKIC

HMMPfam: PF00560
IPR001611
631-653 LRR_1
Leucine-rich repeat

LQALNLRHNRLSGLLPENIFESL

Gene3D: G3DSA:3.80.10.10
638-753 G3DSA:3.80.10.10

HNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDE

HMMPfam: PF00560
IPR001611
722-743 LRR_1
Leucine-rich repeat

KLRIIDISGNQFNGTLPANFFV

Gene3D: G3DSA:3.80.10.10
799-905 G3DSA:3.80.10.10

IDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQNKLSGEIPQELGKLTYLAYMNFSHNQLVGLLPGGTQFQTQKCSSFEDNHGLYGP

HMMPfam: PF13516
844-864 LRR_6,Leucine Rich repeat

LESLDVSQNKLSGEIPQELGK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox