PRGDB00049193 (RPP4)

From PRG Wiki
Jump to: navigation, search
RPP4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20270889 (AF440696)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP4 (RPP4) gene, complete cds.

DNA Sequence

ATGGCTTCTTCTTCTTCTTCTCCTAGTAGCCGGAGATACGACGTTTTCCCAAGCTTCAGTGGGGTAGATGTTCGCAAAACGTTCCTCAGCCATCTAATCGAGGCGCTCGACCGCAGATCAATCAATACATTCATGGATCACGGCATCGTGAGAAGCTGCATAATCGCCGATGCGCTTATAACGGCCATTAGAGAAGCGAGGATCTCAATAGTCATCTTCTCTGAGAACTATGCTTCTTCAACGTGGTGCTTGAATGAATTGGTGGAGATCCACAAGTGTTACAAGAAAGGGGAACAAATGGTGATTCCGGTTTTCTACGGCGTTGATCCTTCTCATGTTAGAAAACAGATCGGTGGCTTTGGCGATGTCTTTAAAAAGACATGCGAGGACAAACCAGAGGATCAGAAACAAAGATGGGTTAAAGCTCTCACAGATATATCAAATTTAGCCGGGGAGGATCTTCGGAACGGGCCTACTGAAGCGTTTATGGTTAAAAAGATAGCCAATGATGTTTCGAATAAACTTTTTCCTCTGCCAAAGGGTTTTGGTGACTTCGTCGGAATTGAAGATCATATAAAGGCAATAAAATCAATACTTTGCTTGGAATCCAAGGAAGCTAGAATAATGGTCGGGATTTGGGGACAGTCAGGGATTGGTAAGAGTACCATAGGAAGAGCTCTTTTCAGTCAACTCTCTAGCCAGTTCCACCATCGCGCTTTCATAACTTATAAAAGCACCAGTGGTAGTGACGTCTCTGGCATGAAGTTGAGTTGGGAAAAAGAACTTCTCTCGGAAATCTTAGGTCAAAAGGACATAAAGATAGATCATTTTGGTGTGGTGGAGCAAAGGTTAAAGCACAAGAAAGTTCTTATCCTTCTTGATGATGTGGATAATCTAGAGTTTCTTAAGACCTTGGTGGGAAAAGCTGAATGGTTTGGTTCTGGAAGCAGAATAATTGTGATCACTCAAGATAAGCAACTTCTCAAGGCTCATGAGATTGACCTTGTATATGAGGTGGAGCTGCCATCTCAAGGTCTTGCTCTTAAGATGATATCCCAATATGCTTTTGGGAAAGACTCTCCACCTGATGATTTTAAGGAACTAGCATTTGAAGTTGCCGAGCTTGTCGGTAGTCTTCCTTTGGGTCTCAGTGTCTTGGGTTCATCTTTAAAAGGAAGGGACAAAGATGAGTGGGTGAAGATGATGCCTAGGCTTCGAAATGATTCAGATGATAAAATTGAGGAAACACTAAGAGTCGGCTACGATAGGTTAAATAAAAAAAATAGAGAGTTATTTAAGTGCATTGCATGTTTTTTCAATGGTTTTAAAGTCAGTAACGTCAAAGAATTACTTGAAGATGATGTTGGGCTTACAATGTTGGCTGATAAGTCCCTCATACGTATTACACCGGATGGAGATATAGAGATGCACAATTTGCTAGAGAAATTGGGTAGAGAAATTGATCGTGCAAAGTCCAAGGGTAATCCTGCAAAACGTCAATTTCTGACGAATTTTGAGGATATTCAAGAAGTAGTGACCGAGAAAACTGGGACAGAAACTGTTCTTGGAATACGTGTGCCACCCACGGTATTATTTTCGACAAGGCCGTTATTAGTAATAAACGAAGAATCGTTCAAAGGCATGCGTAATCTCCAATATCTAGAAATTGGTCATTGGTCAGAAATTGATCTACCTCAGGGCCTCGTTTATTTGCCCCTTAAACTCAAATTGCTAAAATGGAATTATTGTCCATTGAAGTCTTTGCCATCTACTTTTAAGGCGGAATATCTAGTTAACCTCATAATGAAGTATAGTAAGCTTGAGAAACTGTGGGAAGGAACTCTGCCCCTTGGAAGTCTCAAGAAGATGGATTTGGGGTGTTCCAACAATTTGAAAGAAATTCCAGATCTTTCTTTAGCCATAAACCTCGAGGAATTAAATCTTTCTAAATGCGAATCTTTGGTGACACTTCCTTCCTCGATTCAGAATGCCATTAAACTGAGGACGTTATATTGTTCGGGGGTGCTATTAATAGATTTAAAATCATTAGAAGGCATGTGTAATCTCGAATATCTATCAGTTGATTGGTCAAGTATGGAAGGCACTCAAGGCCTCATTTACTTGCCACGTAAACTCAAAAGGCTATGGTGGGATTATTGTCCAGTGAAGCGTTTGCCTTCTAATTTTAAGGCTGAGTATCTAGTTGAACTCAGAATGGAGAATAGTGACCTTGAGAAGCTGTGGGATGGAACTCAGCCACTTGGAAGCCTCAAGGAGATGTATCTGCATGGTTCCAAATATTTGAAAGAAATTCCAGATCTTTCTTTAGCCATAAACCTGGAGAGACTATATCTTTTTGGATGCGAATCTTTGGTGACACTTCCTTCCTCGATTCAGAATGCCACTAAATTGATCAATTTAGATATGAGAGATTGCAAAAAGCTAGAGAGTTTTCCAACCGATCTCAACTTGGAATCTCTCGAGTACCTCAATCTCACTGGATGCCCGAATTTGAGAAATTTCCCAGCAATCAAAATGGGATGTTCATACTTTGAAATTCTGCAAGATAGAAATGAGATCGAGGTAGAAGATTGTTTCTGGAACAAGAATCTCCCTGCTGGACTAGATTATCTCGACTGCCTTATGAGGTGTATGCCTTGTGAATTTCGCCCAGAATATCTCACTTTTCTCGATGTGAGCGGCTGCAAGCATGAGAAGCTATGGGAAGGCATCCAGTCGCTTGGAAGTCTCAAGAGGATGGATCTGTCAGAATCTGAAAACCTGACAGAAATTCCAGATCTTTCGAAGGCCACCAATCTGAAGCGTTTATATCTCAACGGGTGCAAAAGTTTGGTGACACTTCCTTCTACAATTGGGAATCTTCATAGATTGGTGAGGTTGGAAATGAAAGAATGCACAGGGCTGGAGCTTCTTCCAACCGATGTCAACTTGTCATCTCTTATCATCCTCGATCTCAGTGGTTGCTCAAGTCTGAGAACTTTTCCTCTGATTTCAACTAGAATCGAATGTCTCTATCTAGAAAACACCGCCATTGAAGAAGTTCCCTGCTGCATTGAGGATTTAACGAGGCTCAGTGTACTACTGATGTATTGTTGCCAGAGGTTGAAAAACATCTCCCCAAACATTTTCAGACTGACAAGTCTAATGGTCGCCGACTTTACAGACTGTAGAGGTGTCATCAAGGCGTTGAGTGATGCAACTGTGGTAGCGACAATGGAAGATCATGTTTCTTGTGTACCATTATCTGAAAACATTGAATATACATGTGAACGTTTCTGGGATGAGTTGTATGAAAGAAATTCCAGATCTATCTTTAGCTATAAAGATGAGGATGGCGACGTATATTGGGTAAATTGGGACTTAATGATGATGCTGATGTTGATATAG


Protein sequences

Name Description Sequence
disease resistance protein RPP4 disease resistance protein RPP4 [Arabidopsis thaliana].

MASSSSSPSSRRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGEDLRNGPTEAFMVKKIANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEILQDRNEIEVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDELYERNSRSIFSYKDEDGDVYWVNWDLMMMLMLI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSSPSSRRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGE

Gene3D: G3DSA:3.40.50.10140
10-143 G3DSA:3.40.50.10140

SRRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKAL

ProfileScan: PS50104
IPR000157
11-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RRYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNL

HMMSmart: SM00255
IPR000157
12-149 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNL

HMMPfam: PF01582
IPR000157
15-144 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALT

HMMPanther: PTHR11017
34-1124 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGEDLRNGPTEAFMVKKIANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEILQDRNEIEVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDELYERNSRSIFSYKDEDGDVYWV

HMMPanther: PTHR11017:SF20
34-1124 PTHR11017:SF20,SUBFAMILY NOT NAMED

EALDRRSINTFMDHGIVRSCIIADALITAIREARISIVIFSENYASSTWCLNELVEIHKCYKKGEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCEDKPEDQKQRWVKALTDISNLAGEDLRNGPTEAFMVKKIANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEILQDRNEIEVEDCFWNKNLPAGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRGVIKALSDATVVATMEDHVSCVPLSENIEYTCERFWDELYERNSRSIFSYKDEDGDVYWV

superfamily: SSF52540
168-413 SSF52540

ANDVSNKLFPLPKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKI

Gene3D: G3DSA:3.40.50.300
179-329 G3DSA:3.40.50.300

PKGFGDFVGIEDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLK

HMMPfam: PF00931
IPR002182
189-446 NB-ARC,NBS
NB-ARC

EDHIKAIKSILCLESKEARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPSQGLALKMISQYAFGKDSPPDDFKELAFEVAELVGSLPLGLSVLGSSLKGRDKDEWVKMMPRLRNDSDDKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSN

HMMSmart: SM00382
IPR003593
206-343 AAA,NBS
AAA+ ATPase domain

ARIMVGIWGQSGIGKSTIGRALFSQLSSQFHHRAFITYKSTSGSDVSGMKLSWEKELLSEILGQKDIKIDHFGVVEQRLKHKKVLILLDDVDNLEFLKTLVGKAEWFGSGSRIIVITQDKQLLKAHEIDLVYEVELPS

FPrintScan: PR00364
IPR000767
209-224 DISEASERSIST
Disease resistance protein

MVGIWGQSGIGKSTIG

FPrintScan: PR00364
IPR000767
283-297 DISEASERSIST
Disease resistance protein

RLKHKKVLILLDDVD

FPrintScan: PR00364
IPR000767
376-390 DISEASERSIST
Disease resistance protein

VGSLPLGLSVLGSSL

superfamily: SSF46785
411-513 SSF46785

DKIEETLRVGYDRLNKKNRELFKCIACFFNGFKVSNVKELLEDDVGLTMLADKSLIRITPDGDIEMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVT

superfamily: SSF52058
475-854 SSF52058,LRR

EMHNLLEKLGREIDRAKSKGNPAKRQFLTNFEDIQEVVTEKTGTETVLGIRVPPTVLFSTRPLLVINEESFKGMRNLQYLEIGHWSEIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLEYLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEIL

Gene3D: G3DSA:3.80.10.10
540-690 G3DSA:3.80.10.10

INEESFKGMRNLQYLEIGHWSEIDLPQGLVYLPLKLKLLKWNYCPLKSLPSTFKAEYLVNLIMKYSKLEKLWEGTLPLGSLKKMDLGCSNNLKEIPDLSLAINLEELNLSKCESLVTLPSSIQNAIKLRTLYCSGVLLIDLKSLEGMCNLE

HMMPfam: PF07725
IPR011713
596-614 LRR_3
Leucine-rich repeat 3

YLVNLIMKYSKLEKLWEGT

HMMPfam: PF00560
IPR001611
642-663 LRR_1
Leucine-rich repeat

NLEELNLSKCESLVTLPSSIQN

Gene3D: G3DSA:3.80.10.10
691-854 G3DSA:3.80.10.10

YLSVDWSSMEGTQGLIYLPRKLKRLWWDYCPVKRLPSNFKAEYLVELRMENSDLEKLWDGTQPLGSLKEMYLHGSKYLKEIPDLSLAINLERLYLFGCESLVTLPSSIQNATKLINLDMRDCKKLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSYFEIL

HMMPfam: PF07725
IPR011713
733-752 LRR_3
Leucine-rich repeat 3

YLVELRMENSDLEKLWDGTQ

HMMPfam: PF00560
IPR001611
779-800 LRR_1
Leucine-rich repeat

NLERLYLFGCESLVTLPSSIQN

HMMPfam: PF00560
IPR001611
826-843 LRR_1
Leucine-rich repeat

SLEYLNLTGCPNLRNFPA

Gene3D: G3DSA:3.80.10.10
873-1061 G3DSA:3.80.10.10

AGLDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFT

superfamily: SSF52058
875-1065 SSF52058,LRR

LDYLDCLMRCMPCEFRPEYLTFLDVSGCKHEKLWEGIQSLGSLKRMDLSESENLTEIPDLSKATNLKRLYLNGCKSLVTLPSTIGNLHRLVRLEMKECTGLELLPTDVNLSSLIILDLSGCSSLRTFPLISTRIECLYLENTAIEEVPCCIEDLTRLSVLLMYCCQRLKNISPNIFRLTSLMVADFTDCRG

HMMPfam: PF00560
IPR001611
939-961 LRR_1
Leucine-rich repeat

NLKRLYLNGCKSLVTLPSTIGNL

FPrintScan: PR00364
IPR000767
982-998 DISEASERSIST
Disease resistance protein

VNLSSLIILDLSGCSSL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox