PRGDB00049194 (not annotated)

From PRG Wiki
Jump to: navigation, search
not annotated
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20260615 (AY093207)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein homolog (not annotated) mRNA, complete cds.

DNA Sequence

ATGTTGATTCCGAATCTCGTAAAAGACGAAAGATATGCTCAACAAACGATGCTGAGAATTGCAGATTCATTCAGGATGAGTCATCTTGGAAACATCCATGGAGTTTATGTGTCAACGTGGCAGCCGCAGCTTTTACAAAATTCAGATTCCAACAAGACAACAAATATACTAAATCTTCTGCTTTATCTCTTCCATCTCCTCCAACTTCAGTGTCTCGAATCTGGAAACACCACGTCTTCCCGAGCTTCCACGGGGCAGATGTTCGAAAAACCATTCTTAGTCACATCCTCGAATCGTTCAGAAGAAAGGGAATTGACCCATTTATTGATAATAATATAG


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Arabidopsis thaliana].

MLIPNLVKDERYAQQTMLRIADSFRMSHLGNIHGVYVSTWQPQLLQNSDSNKTTNILNLLLYLFHLLQLQCLESGNTTSSRASTGQMFEKPFLVTSSNRSEERELTHLLIII







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox