PRGDB00049196 (RPP5)

From PRG Wiki
Jump to: navigation, search
RPP5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 19569146 (AF486235)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Camelina sativa

Comment?

Camelina sativa NBS-LRR disease resistance protein RPP5-like protein (RPP5) gene, partial cds.

DNA Sequence

TCCTAACTTATAAAAGCACCAGAAAGGACTTAATGGGAATGAAGTTGAGTTGGGAAAAAGAATTTCTCTCCGAAATCTTAGGTCAAAAGGACATAAAGGTCGAGCATTTAGGTGAGGTGAAGCGAAGGTTAAAGCACAAGAAAGTTCTTGTCGTTCTTGATGATGTGGATGATCTAGAGTTACTTAAGACCTTGGTGGGTGAAACTGAATGGTTTGGACCTGGAAGCAGAATAATTGTGATCACTCAAGATAGGCAACTTCTCAAGGCTCATAAGATTGACACTATTTATGAGGTGGAGTTGCCTTCAGAAGCTCTTGCTATTAAGATGTTATGCCGATTTGCTTTTGGACAAGACTATCCACCTTATGATTTTATGGAGCTCGCAATTGAAGTTGCCAAGCTTGCTGGCAACCTTCCTTTGGGTCTCAGTGTATTGGGTTCGTCTTTAAAAGAAAGGGGCAAAGATGAGTGGGTGGAGATGATGCCTAGGCTCCGAAATGATTCAGATGATAAAATTGAGGAAACACTAAGAGTTGGCTACAAAAGGTTAAATAAAAAAGATCGAGAGTTATTTAAGTGCATTGCATGTTTTTTC


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein RPP5-like protein NBS-LRR disease resistance protein RPP5-like protein [Camelina sativa].

LTYKSTRKDLMGMKLSWEKEFLSEILGQKDIKVEHLGEVKRRLKHKKVLVVLDDVDDLELLKTLVGETEWFGPGSRIIVITQDRQLLKAHKIDTIYEVELPSEALAIKMLCRFAFGQDYPPYDFMELAIEVAKLAGNLPLGLSVLGSSLKERGKDEWVEMMPRLRNDSDDKIEETLRVGYKRLNKKDRELFKCIACFF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
3-198 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YKSTRKDLMGMKLSWEKEFLSEILGQKDIKVEHLGEVKRRLKHKKVLVVLDDVDDLELLKTLVGETEWFGPGSRIIVITQDRQLLKAHKIDTIYEVELPSEALAIKMLCRFAFGQDYPPYDFMELAIEVAKLAGNLPLGLSVLGSSLKERGKDEWVEMMPRLRNDSDDKIEETLRVGYKRLNKKDRELFKCIACFF

HMMPanther: PTHR11017:SF20
3-198 PTHR11017:SF20,SUBFAMILY NOT NAMED

YKSTRKDLMGMKLSWEKEFLSEILGQKDIKVEHLGEVKRRLKHKKVLVVLDDVDDLELLKTLVGETEWFGPGSRIIVITQDRQLLKAHKIDTIYEVELPSEALAIKMLCRFAFGQDYPPYDFMELAIEVAKLAGNLPLGLSVLGSSLKERGKDEWVEMMPRLRNDSDDKIEETLRVGYKRLNKKDRELFKCIACFF

superfamily: SSF52540
19-172 SSF52540

KEFLSEILGQKDIKVEHLGEVKRRLKHKKVLVVLDDVDDLELLKTLVGETEWFGPGSRIIVITQDRQLLKAHKIDTIYEVELPSEALAIKMLCRFAFGQDYPPYDFMELAIEVAKLAGNLPLGLSVLGSSLKERGKDEWVEMMPRLRNDSDDKI

HMMPfam: PF00931
IPR002182
28-197 NB-ARC,NBS
NB-ARC

QKDIKVEHLGEVKRRLKHKKVLVVLDDVDDLELLKTLVGETEWFGPGSRIIVITQDRQLLKAHKIDTIYEVELPSEALAIKMLCRFAFGQDYPPYDFMELAIEVAKLAGNLPLGLSVLGSSLKERGKDEWVEMMPRLRNDSDDKIEETLRVGYKRLNKKDRELFKCIACF

Gene3D: G3DSA:3.40.50.300
33-114 G3DSA:3.40.50.300

VEHLGEVKRRLKHKKVLVVLDDVDDLELLKTLVGETEWFGPGSRIIVITQDRQLLKAHKIDTIYEVELPSEALAIKMLCRFA

FPrintScan: PR00364
IPR000767
42-56 DISEASERSIST
Disease resistance protein

RLKHKKVLVVLDDVD

FPrintScan: PR00364
IPR000767
135-149 DISEASERSIST
Disease resistance protein

AGNLPLGLSVLGSSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox