PRGDB00049197 (RPM1)

From PRG Wiki
Jump to: navigation, search
RPM1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18072145 (AF457596)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Camelina sativa

Comment?

Camelina sativa NBS-LRR disease resistance protein RPM1-like protein (RPM1) gene, partial cds.

DNA Sequence

GGTTCAGGGAAAACTACACTCGCAGCGAACATCTTTAAGTCCCAAAGTGTCCGGAAACATTTTGAGTCTAACGCTTGGGTAACAATCTCGAAATCTTATGTTATTGAAGATGTGTTTAGGAACATGATCAAGGAGTTTTACAAAGAAGCACAAACACAGATTCCAGCTGAATTATACTCCTTAAGCTACAGAGAGTTGGTGGAAAAACTTGTGGAGTATTTGCAGTCAAAGAGGTACATTGTTGTGCTTGATGATGTATGGACCACCGGTCTATGGAGGGAGATAAGTATCGCTCTACCAGATGGTATTTGTGGAAGTCGTGTTATGATAACCACTCGGAGCATGAACGTGGCTTCTTTCTCATATGGCATTGGGAGCCAAAAGTACGAGATTGAGCTCTTGAAAGAAGACGAAGCTTGGGTGCTTTTCTGCAACAGAGCGTTTTCAGGAAGTCTTGAGCAATGCAGAGAGCGAAATCTGGAGCCGATAGCACGGAAATTACTCGAGAGATGTCAGGGTTTGCCATTAGCT


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein RPM1-like protein NBS-LRR disease resistance protein RPM1-like protein [Camelina sativa].

GSGKTTLAANIFKSQSVRKHFESNAWVTISKSYVIEDVFRNMIKEFYKEAQTQIPAELYSLSYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGICGSRVMITTRSMNVASFSYGIGSQKYEIELLKEDEAWVLFCNRAFSGSLEQCRERNLEPIARKLLERCQGLPLA

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-177 NB-ARC,NBS
NB-ARC

GSGKTTLAANIFKSQSVRKHFESNAWVTISKSYVIEDVFRNMIKEFYKEAQTQIPAELYSLSYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGICGSRVMITTRSMNVASFSYGIGSQKYEIELLKEDEAWVLFCNRAFSGSLEQCRERNLEPIARKLLERCQGLPLA

HMMPanther: PTHR23155
1-110 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GSGKTTLAANIFKSQSVRKHFESNAWVTISKSYVIEDVFRNMIKEFYKEAQTQIPAELYSLSYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGICGSRVMI

Gene3D: G3DSA:3.40.50.300
1-119 G3DSA:3.40.50.300

GSGKTTLAANIFKSQSVRKHFESNAWVTISKSYVIEDVFRNMIKEFYKEAQTQIPAELYSLSYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGICGSRVMITTRSMNVAS

HMMPanther: PTHR23155:SF234
1-110 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

GSGKTTLAANIFKSQSVRKHFESNAWVTISKSYVIEDVFRNMIKEFYKEAQTQIPAELYSLSYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGICGSRVMI

superfamily: SSF52540
1-177 SSF52540

GSGKTTLAANIFKSQSVRKHFESNAWVTISKSYVIEDVFRNMIKEFYKEAQTQIPAELYSLSYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGICGSRVMITTRSMNVASFSYGIGSQKYEIELLKEDEAWVLFCNRAFSGSLEQCRERNLEPIARKLLERCQGLPLA

FPrintScan: PR00364
IPR000767
73-87 DISEASERSIST
Disease resistance protein

YLQSKRYIVVLDDVW

FPrintScan: PR00364
IPR000767
171-177 DISEASERSIST
Disease resistance protein

CQGLPLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox