PRGDB00049198 (At1g58390; F9K23.8)

From PRG Wiki
Jump to: navigation, search
At1g58390; F9K23.8
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 17065443 (AY062798)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein, putative (At1g58390; F9K23.8) mRNA, partial cds.

DNA Sequence

AACAGAAGAGTTCCTCGACGCCATCAAGAGGAGCAACTATGGCTGGAGAACTTGTGTCGTTTGGAATAAAAAAGCTTTGGGACCTACTGAGTCAAGAATGCGAGCAATTTCAGGGAGTTGAAGATCAAGTTACTGGACTAAAACGTGATCTAAACTTGTTAAGCTCTTTTCTAAAAGATGCAGATGCAAAGAAACATACAACTGCGGTGGTGAGAAATGTTGTCGAAGAAATAAAGGAAATTGTTTACGACGCAGAAGATATAATTGAAACATATCTTCTTAAAGAAAAACTTTGGAAAACAAGTGGAATCAAGATGCGTATCAGAAGACATGCTTGCATTATTTCAGATCGTAGGAGAAATGCATTAGATGTTGGAGGCATACGTACGAGGATCTCGGATGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGTTATATGCAACCTCAAGGTGATAGACAAAGGGAGATGCGACAAACGTTTTCTAAGGACTACGAAAGCGATTTTGTGGGGTTGGAGGTAAATGTTAAGAAACTGGTTGGATATTTGGTGGACGAAGAAAACGTTCAAGTGGTTTCCATAACCGGGATGGGTGGTCTAGGTAAAACCACACTTGCTAGACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATAGACTCGCATGGGTGTGTGTCTCACAAGAGTTTACTCGGAAGAATGTATGGCAAATGATCTTGCAGAATCTAACCTCTAGAGAAAAGAAAGATGAAATCTTGCAAATGGAAGAAGCTGAACTCCATGATAAACTCTTTCAGCTATTGGAGACATCTAAATCATTAATTGTCTTTGATGACATATGGAAAGACGAAGATTGGGACCTAATAAAGCCAATATTTCCACCCAATAAAGGTTGGAAGGTGCTTCTTACTTCTCAAAATGAGAGTGTCGCGGTACGTGGGGATATAAAATATCTCAACTTTAAACCAGAATGCCTAGCCATTGAGGATAGTTGGACACTTTTCCAAAGAATAGCATTTCCAAAGAAAGATGCATCTGAATCTAAGGTTGACGAGGAAATGGAAGATATGGGTAAGCAAATGTTAAAACATTGTGGAGGGCTACCATTAGCCATCAAAGTGTTAGGAGGTTTGTTAGCTGCAAAGTACACAATGCATGATTGGGAAAGACTATCCGTAAATATCGGATCTGATATCGTGGGAAGAACCAGCAGTAACAACAGTTCAATATACCATGTATTGTCTATGAGCTTTGAGGAGTTGCCTAGTTATTTGAAACATTGTTTCCTCTACCTGGCCCATTTTCCAGAAGATCATAAGATTAACGTGGAGAAATTGTCTTATTGTTGGGCTGCAGAAGGAATATCCACCGCCGAAGATTATCACAATGGAGAGACCATTCAAGATGTTGGACAGAGCTACCTAGAGGAGTTAGTGAGGAGGAATATGATAATTTGGGAAAGAGATGCTACTGCTTCGAGATTTGGAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTTAAAGCCAAGGAAGAAAACTTCCTACAAATTGCTGTAAAAAGTGTAGGTGTAACCAGCTCCTCGACCGGAAACTCTCAATCTCCTTGTAGATCTCGCAGGCTTGTCTACCAATGTCCAACTACATTACATGTTGAGAGAGATATAAACAATCCAAAACTTAGATCTCTCGTGGTTCTCTGGCATGATTTATGGGTAGAAAATTGGAAGCTATTAGGTACAAGCTTTACAAGGTTAAAACTTCTGA


Protein sequences

Name Description Sequence
disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

QKSSSTPSRGATMAGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
23-595 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRL

HMMPanther: PTHR11017:SF125
23-595 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

KKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRL

superfamily: SSF52540
158-410 P-loop containing nucleoside triphosphate hydrolases

DRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRT

HMMPfam: PF00931
IPR002182
180-467 NB-ARC,NBS
NB-ARC

VNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAED

Gene3D: G3DSA:3.40.50.300
192-316 no description

EENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNES

FPrintScan: PR00364
IPR000767
197-212 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

LLETSKSLIVFDDIW

FPrintScan: PR00364
IPR000767
372-386 DISEASERSIST
Disease resistance protein

CGGLPLAIKVLGGLL

Seg: seg
531-544 seg

SVGVTSSSTGNSQS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox