PRGDB00049199 (At5g43470; MWF20.19)

From PRG Wiki
Jump to: navigation, search
At5g43470; MWF20.19
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 17064875 (AY062514)
Gene Class CNL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP8 (At5g43470; MWF20.19) mRNA, complete cds.

DNA Sequence

ATGGCTGAAGCATTTGTGTCGTTTGGACTTGAGAAGCTTTGGGATCTCCTGAGTCGAGAATCAGAGCGATTGCAGGGAATTGATGGGCAACTTGATGGACTAAAGCGTCAGCTGAGAAGTTTACAGTCGTTGTTGAAAGATGCAGATGCCAAGAAACATGGAAGTGATAGGGTGAGGAATTTCTTGGAAGATGTCAAAGACCTTGTTTTTGATGCTGAGGATATAATTGAATCCTATGTTCTGAACAGACTTAGTGGAAAAGGAAAAGGGGTCAAGAAGCATGTGAGACGACTTGCTTGCTTCTTGACGGATCGCCACAAGGTTGCTTCAGATATCGAGGGTATCACTAAGAGGATCTCTGAAGTGATTGGGGAAATGCAGAGTTTTGGGATACAACAAATCATTGATGGTGGTCGTTCGCTGTCTCTTCAGGAAAGACAAAGGGTGCAGAGGGAGATCCGACAAACGTATCCTGACAGTTCTGAAAGCGATCTTGTCGGGGTGGAGCAGAGTGTTAAAGAATTGGTTGGTCATTTGGTGGAGAATGATGTTCATCAAGTGGTTTCTATAGCTGGGATGGGCGGTATTGGTAAAACCACTCTGGCTAGACAAGTCTTTCATCATGACTTAGTCCGGCGTCACTTTGATGGATTCGCATGGGTCTGTGTTTCCCAACAATTTACACAGAAACATGTTTGGCAGAGGATCTTGCAAGAACTTCAGCCACATGATGGGGATATTTTACAGATGGACGAATATGCACTTCAGCGTAAACTCTTTCAATTGTTAGAGGCCGGTAGATATTTAGTTGTCCTCGATGATGTATGGAAAAAAGAAGACTGGGATGTAATAAAAGCAGTGTTTCCACGGAAAAGAGGTTGGAAGATGCTGCTTACTTCTCGAAATGAAGGTGTTGGGATACATGCTGATCCAACATGTTTAACTTTTAGAGCAAGCATCCTTAACCCTGAAGAAAGTTGGAAGCTCTGTGAGAGAATAGTATTCCCTAGGAGAGATGAAACTGAAGTAAGGCTTGATGAAGAAATGGAAGCCATGGGAAAGGAAATGGTCACACATTGTGGAGGACTACCATTAGCTGTTAAAGCGTTGGGAGGCTTGTTAGCTAATAAACATACTGTTCCTGAGTGGAAAAGAGTTTTTGACAATATTGGATCTCAAATAGTAGGAGGATCGTGGTTAGATGACAACAGTCTCAATTCGGTTTACCGAATATTGTCTCTGAGTTATGAAGATTTGCCAACGCATTTAAAGCATTGCTTCCTTAACCTAGCCCATTTCCCCGAAGATTCCGAGATATCTACGTATAGTTTGTTCTATTACTGGGCTGCAGAAGGGATTTACGATGGATCAACCATCGAAGATAGTGGAGAATACTACCTAGAAGAGCTAGTGAGGAGAAATTTGGTTATTGCAGACGACAACTATTTGAGTTGGCAATCTAAATATTGTCAAATGCATGACATGATGAGAGAAGTATGTTTATCTAAAGCCAAAGAAGAGAACTTCCTACAAATTATCATAGACCCTACTTGCACCTCTACCATCAATGCTCAATCTCCTAGTAGATCTCGCAGACTCAGCATACATAGTGGTAAAGCCTTTCATATATTGGGACACAAAAACAAGACAAAGGTGAGATCTCTTATAGTTCCGAGATTCGAGGAAGACTATTGGATACGATCAGCTTCAGTCTTCCACAACTTAACATTGCTCAGGGTGTTGGATCTTTCTTGGGTAAAGTTTGAAGGAGGGAAGTTACCTTGTAGCATTGGAGGGCTCATCCACTTGAGATACTTGAGTTTATACGAGGCTAAGGTATCTCATCTACCTTCTACTATGCGGAACCTAAAGCTTCTGCTCTATTTGAACTTACGTGTTGATACCGAGGAACCGATTCACGTGCCAAATGTTTTGAAAGAGATGATACAGTTGAGGTACCTTTCCCTACCTCTTAAAATGGATGATAAAACCAAGTTGGAATTGGGTGATCTAGTGAACCTGGAGTACTTGTATGGTTTCTCAACGCAACACAGTGGTGTGACAGACCTCCTCCGTATGACTAAGCTCCGGTATCTCGCTGTATCTTTGAGCGAAAGGTGCAATTTTGAAACTCTATCGTCATCTCTCCGCGAATTGCGAAACCTCGAGACGCTTAATTTCCTTTTTTCGCTCGAAACATATATGGTTGATTATATGGGAGAGTTTGTTCTGGATCATTTTATTCATCTAAAACAGTTGGGATTGGCAGTACGTATGTCAAAGATTCCTGATCAACATCAATTCCCTCCCCACCTTGTACACTTATTTCTAATTTATTGCGGCATGGAAGAGGATCCAATGCCAATTCTAGAAAAGTTGCTTCATTTGAAGTCGGTTCGTTTAGCACGTAAGGCATTCCTAGGGAGCAGAATGGTGTGCTCAAAAGGCGGATTTCCTCAATTATGTGTTATAGAAATATCTAAAGAATCAGAGTTGGAAGAGCGGATAGTAGAAGAAGGGTCGATGCCATGTCTTCGTACTTTGACTATAGATGATTGCAAAAAGTTGAAGGAACTTCCAGATGGACTCAAGTACATAACATCCTTAAAGGAACTGAAGATTGAAGGAATGAAGAGGGAGTGGAAGGAGAAACTGGTACCAGGTGGAGAAGATTACTACAAAGTCCAACACATTCCCGATGTTCAATTTATCAACTGTGACCAGTAG


Protein sequences

Name Description Sequence
disease resistance protein RPP8 disease resistance protein RPP8 [Arabidopsis thaliana].

MAEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNRLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSGVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEERIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCDQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-907 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNRLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSGVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEERIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

HMMPanther: PTHR23155:SF231
2-907 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AEAFVSFGLEKLWDLLSRESERLQGIDGQLDGLKRQLRSLQSLLKDADAKKHGSDRVRNFLEDVKDLVFDAEDIIESYVLNRLSGKGKGVKKHVRRLACFLTDRHKVASDIEGITKRISEVIGEMQSFGIQQIIDGGRSLSLQERQRVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYDGSTIEDSGEYYLEELVRRNLVIADDNYLSWQSKYCQMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSGVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEERIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIPDVQFINCD

Coil: coil
24-52 coiled-coil

LQGIDGQLDGLKRQLRSLQSLLKDADAKK

Seg: seg
34-46 seg

LKRQLRSLQSLLK

Seg: seg
86-93 seg

GKGKGVKK

Seg: seg
144-155 seg

QERQRVQREIRQ

superfamily: SSF52540
148-396 P-loop containing nucleoside triphosphate hydrolases

RVQREIRQTYPDSSESDLVGVEQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVG

HMMPfam: PF00931
IPR002182
169-455 NB-ARC,NBS
NB-ARC

EQSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGWKMLLTSRNEGVGIHADPTCLTFRASILNPEESWKLCERIVFPRRDETEVRLDEEMEAMGKEMVTHCGGLPLAVKALGGLLANKHTVPEWKRVFDNIGSQIVGGSWLDDNSLNSVYRILSLSYEDLPTHLKHCFLNLAHFPEDSEISTYSLFYYWAAEGIYD

Gene3D: G3DSA:3.40.50.300
170-294 no description

QSVKELVGHLVENDVHQVVSIAGMGGIGKTTLARQVFHHDLVRRHFDGFAWVCVSQQFTQKHVWQRILQELQPHDGDILQMDEYALQRKLFQLLEAGRYLVVLDDVWKKEDWDVIKAVFPRKRGW

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

VVSIAGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLEAGRYLVVLDDVW

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAVKALGGLL

superfamily: SSF52058
491-876 L domain-like,LRR

QMHDMMREVCLSKAKEENFLQIIIDPTCTSTINAQSPSRSRRLSIHSGKAFHILGHKNKTKVRSLIVPRFEEDYWIRSASVFHNLTLLRVLDLSWVKFEGGKLPCSIGGLIHLRYLSLYEAKVSHLPSTMRNLKLLLYLNLRVDTEEPIHVPNVLKEMIQLRYLSLPLKMDDKTKLELGDLVNLEYLYGFSTQHSGVTDLLRMTKLRYLAVSLSERCNFETLSSSLRELRNLETLNFLFSLETYMVDYMGEFVLDHFIHLKQLGLAVRMSKIPDQHQFPPHLVHLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEERIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEG

Seg: seg
622-631 seg

NLKLLLYLNL

Seg: seg
709-729 seg

FETLSSSLRELRNLETLNFLF

Gene3D: G3DSA:3.80.10.10
774-876 no description

HLFLIYCGMEEDPMPILEKLLHLKSVRLARKAFLGSRMVCSKGGFPQLCVIEISKESELEERIVEEGSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEG

FPrintScan: PR00364
IPR000767
840-856 DISEASERSIST
Disease resistance protein

GSMPCLRTLTIDDCKKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox