PRGDB00049200 (RGA)

From PRG Wiki
Jump to: navigation, search
RGA
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13937099 (AF363804)
Gene Class NL
Domain Type NBS, LRR
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris putative disease resistance protein OB9 (RGA) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACACTTGCAAATACATTGTTTAAAAAAATCTCTCCTAAATACGATGCTTGGTGTTACATTGATGATTTAAGTAAAATTTATTTGGATCTTGGAGTAACAAGTGCACAAAAACAACTTCTTTGTCAAGTTCTAAATCAAGGAAATATGGAGATACACCATGTTTCCCATGGAACTATGTTGATGAAAAATAGGCTACGTCACTTAAAGACGCTTATTGTTCTTGATAATGTTGATCAGGTTGAACAGTTAGAGAAATTGGGTTTGCATCCTGAATATATAGGTCCAGGTAGTAGGATCATTATAATTTCTACCGATTGTCGTATCTTACAAAATTATGGAGTAAATGAAGTTTACAATGTTAAAGTCTTGGATGAAACTCAAGCTCTTAAATTATTTTGCAAAAGAGCTTTCAAATCTAAGGATATTCCGAAAGAATATGAAGAGTTGACATTTGATGTATTGAAGTATGTGAAAGGCCTCCCCCTCGCCCTC


Protein sequences

Name Description Sequence
putative disease resistance protein OB9 putative disease resistance protein OB9 [Phaseolus vulgaris].

GGVGKTTLANTLFKKISPKYDAWCYIDDLSKIYLDLGVTSAQKQLLCQVLNQGNMEIHHVSHGTMLMKNRLRHLKTLIVLDNVDQVEQLEKLGLHPEYIGPGSRIIIISTDCRILQNYGVNEVYNVKVLDETQALKLFCKRAFKSKDIPKEYEELTFDVLKYVKGLPLAL


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-170 NB-ARC,NBS
NB-ARC

GGVGKTTLANTLFKKISPKYDAWCYIDDLSKIYLDLGVTSAQKQLLCQVLNQGNMEIHHVSHGTMLMKNRLRHLKTLIVLDNVDQVEQLEKLGLHPEYIGPGSRIIIISTDCRILQNYGVNEVYNVKVLDETQALKLFCKRAFKSKDIPKEYEELTFDVLKYVKGLPLAL

HMMPanther: PTHR11017
1-170 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLANTLFKKISPKYDAWCYIDDLSKIYLDLGVTSAQKQLLCQVLNQGNMEIHHVSHGTMLMKNRLRHLKTLIVLDNVDQVEQLEKLGLHPEYIGPGSRIIIISTDCRILQNYGVNEVYNVKVLDETQALKLFCKRAFKSKDIPKEYEELTFDVLKYVKGLPLAL

superfamily: SSF52540
1-170 SSF52540

GGVGKTTLANTLFKKISPKYDAWCYIDDLSKIYLDLGVTSAQKQLLCQVLNQGNMEIHHVSHGTMLMKNRLRHLKTLIVLDNVDQVEQLEKLGLHPEYIGPGSRIIIISTDCRILQNYGVNEVYNVKVLDETQALKLFCKRAFKSKDIPKEYEELTFDVLKYVKGLPLAL

HMMPanther: PTHR11017:SF20
1-170 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGVGKTTLANTLFKKISPKYDAWCYIDDLSKIYLDLGVTSAQKQLLCQVLNQGNMEIHHVSHGTMLMKNRLRHLKTLIVLDNVDQVEQLEKLGLHPEYIGPGSRIIIISTDCRILQNYGVNEVYNVKVLDETQALKLFCKRAFKSKDIPKEYEELTFDVLKYVKGLPLAL

Gene3D: G3DSA:3.40.50.300
2-17 G3DSA:3.40.50.300

GVGKTTLANTLFKKIS

Gene3D: G3DSA:3.40.50.300
100-131 G3DSA:3.40.50.300

GPGSRIIIISTDCRILQNYGVNEVYNVKVLDE


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox