PRGDB00049201 (RGA)

From PRG Wiki
Jump to: navigation, search
RGA
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13937097 (AF363803)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris putative disease resistance protein OB8 (RGA) gene, partial cds.

DNA Sequence

GGGGGGTGGGGAAGACGACAATTTGCTAGATTAGTCTATGAAGCAGTCAAAGAGAAATTCAAGTTAAGTTGCTTTCTTGAAAACATCAGAGAATTGTCCAAGACAAATGGCTTAGTTCACATTCAAAAGGAAATTCTTTCTCATCTTAATGTAAGAAGCAATGATTTTTGTAATCTTTATGATGGGAAAAAGATAATAGCAAACTCTTTAAGCAACAAAAAGGTACTTCTTGTTCTTGATGATGTAAGTGACATAAGCCAATTGGAGAATTTAGGTGGAAAAAGAGAATGGTTTGGTCCAGGAAGCAGACTAATAATCACAACTAGAGATAAGCACCTGCTAAAGACATATGGAGTGGATATGACTTATAAGGCTAGAGGCTTAGCCCAAAATGAAGCCCTTCAGCTCTTTTGCTTGAAAGCATTTAAACAAGATCAACCTAAAGAAGGGTATTTGAATTTGTGCAAAGGAGTGGTTGAATATGCAAGAGGCCTCCCCTTCGCCCTC


Protein sequences

Name Description Sequence
putative disease resistance protein OB8 putative disease resistance protein OB8 [Phaseolus vulgaris].

GGWGRRQFARLVYEAVKEKFKLSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSDISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLKAFKQDQPKEGYLNLCKGVVEYARGLPFAL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-169 SSF52540

GGWGRRQFARLVYEAVKEKFKLSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSDISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLKAFKQDQPKEGYLNLCKGVVEYARGLPFAL

HMMPfam: PF00931
IPR002182
1-169 NB-ARC,NBS
NB-ARC

GGWGRRQFARLVYEAVKEKFKLSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSDISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLKAFKQDQPKEGYLNLCKGVVEYARGLPFAL

HMMPanther: PTHR11017:SF20
9-169 PTHR11017:SF20,SUBFAMILY NOT NAMED

ARLVYEAVKEKFKLSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSDISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLKAFKQDQPKEGYLNLCKGVVEYARGLPFAL

HMMPanther: PTHR11017
9-169 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ARLVYEAVKEKFKLSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSDISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLKAFKQDQPKEGYLNLCKGVVEYARGLPFAL

FPrintScan: PR00364
IPR000767
69-83 DISEASERSIST
Disease resistance protein

SLSNKKVLLVLDDVS

FPrintScan: PR00364
IPR000767
162-169 DISEASERSIST
Disease resistance protein

ARGLPFAL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox