PRGDB00049206 (RGA)

From PRG Wiki
Jump to: navigation, search
RGA
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13937087 (AF363798)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris putative disease resistance protein SB4 (RGA) gene, partial cds.

DNA Sequence

GGGGGGATGGGGAAAACGACACTTGCTAAGTTGATCTTCAAAGACACCAACACTGATGCATGTTTTCCGTTGAAGATGTGGGTGTGTGTCTCTAATGATTTTGAGCTTAGAAATTTGCTCATTAAAATCCTCAATTCTACTCCAAACTCAAATAGGGAAAACTTTAATAACTTGGAGACGGAGCAACTTCAAAATCGTTTGAGAAATACACTTCAAGTTCAGAAGTTTTTGCTCGTGTTGGATGATGTGTGGAATGAGGTTCCTGAAAAGTGGCATGAGTTGAAGGAAATAATAGATGTAGGTGTTGAAGGGAGTGAAATCCTAGTGACTACCCGTAGCCATGCAGTAGCTACCGTGATGCACACTAAATCCTCAAATTCGTATCTTCTACAATGTCTCTCTGAAGAGGATTCTCTTTCTCTATTCGTGAAATATGCTTCTGAAGATGGAATGGAAAAACATCCAGAACTATTGGAGATTGGGAAAGAAATTGTAAAAAAATGTGGAGGCCTCCCCCTCGCCTTC


Protein sequences

Name Description Sequence
putative disease resistance protein SB4 putative disease resistance protein SB4 [Phaseolus vulgaris].

GGMGKTTLAKLIFKDTNTDACFPLKMWVCVSNDFELRNLLIKILNSTPNSNRENFNNLETEQLQNRLRNTLQVQKFLLVLDDVWNEVPEKWHELKEIIDVGVEGSEILVTTRSHAVATVMHTKSSNSYLLQCLSEEDSLSLFVKYASEDGMEKHPELLEIGKEIVKKCGGLPLAF

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-175 SSF52540

GGMGKTTLAKLIFKDTNTDACFPLKMWVCVSNDFELRNLLIKILNSTPNSNRENFNNLETEQLQNRLRNTLQVQKFLLVLDDVWNEVPEKWHELKEIIDVGVEGSEILVTTRSHAVATVMHTKSSNSYLLQCLSEEDSLSLFVKYASEDGMEKHPELLEIGKEIVKKCGGLPLAF

HMMPanther: PTHR11017
1-174 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGMGKTTLAKLIFKDTNTDACFPLKMWVCVSNDFELRNLLIKILNSTPNSNRENFNNLETEQLQNRLRNTLQVQKFLLVLDDVWNEVPEKWHELKEIIDVGVEGSEILVTTRSHAVATVMHTKSSNSYLLQCLSEEDSLSLFVKYASEDGMEKHPELLEIGKEIVKKCGGLPLA

HMMPanther: PTHR11017:SF20
1-174 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGMGKTTLAKLIFKDTNTDACFPLKMWVCVSNDFELRNLLIKILNSTPNSNRENFNNLETEQLQNRLRNTLQVQKFLLVLDDVWNEVPEKWHELKEIIDVGVEGSEILVTTRSHAVATVMHTKSSNSYLLQCLSEEDSLSLFVKYASEDGMEKHPELLEIGKEIVKKCGGLPLA

HMMPfam: PF00931
IPR002182
1-174 NB-ARC,NBS
NB-ARC

GGMGKTTLAKLIFKDTNTDACFPLKMWVCVSNDFELRNLLIKILNSTPNSNRENFNNLETEQLQNRLRNTLQVQKFLLVLDDVWNEVPEKWHELKEIIDVGVEGSEILVTTRSHAVATVMHTKSSNSYLLQCLSEEDSLSLFVKYASEDGMEKHPELLEIGKEIVKKCGGLPLA

Gene3D: G3DSA:3.40.50.300
2-113 G3DSA:3.40.50.300

GMGKTTLAKLIFKDTNTDACFPLKMWVCVSNDFELRNLLIKILNSTPNSNRENFNNLETEQLQNRLRNTLQVQKFLLVLDDVWNEVPEKWHELKEIIDVGVEGSEILVTTRS

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

TLQVQKFLLVLDDVW

FPrintScan: PR00364
IPR000767
168-175 DISEASERSIST
Disease resistance protein

CGGLPLAF


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox