PRGDB00049208 (RGA)

From PRG Wiki
Jump to: navigation, search
RGA
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13937083 (AF363796)
Gene Class TNL
Domain Type NBS, LRR, TIR, Others
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris putative disease resistance protein SB1 (RGA) gene, partial cds.

DNA Sequence

GGGGGGATGGGGAAAACGACCATAGCCAAATCCATTTGCAATGAAATTCGTCATGAATTCAAGTATAAAAGTTATCTTGCAAATATCAGAGAAGCTTGGGGAGGAGGTCGTGGCCCAGTTGATTTGCAAGAACAGCTTCTTTCAGATATCCTTAAAACAAAAAATAAGGTGCATAGCACTGATTGGGGAAAAGGCAAGATCAAGGAAATGCTTTGCACAAAAAAAGTACTTGTTCTTCTTGATGATGTGAGTTCCGTAGAACAGTTAAATGATTTATGTGGAAATCGTGATGCAATTGGTGAAGGAAGTGTCATAATCATCACCACCAGAAACGTACGTCTACTGAGGGAGATTGGTGTTGATTGTGTGCATCGAGTGGAGAAAATGAATGAACTTGAGTCCCTTGAGCTTTTTAGTTGGCATGCTTTGAGGAGAGCCGATCCATGCAGAGACTTGTTTGAACTCTCACAAGAAGTAGTCACATACTGTGGAGGCCTCCCCCTCACCCTC


Protein sequences

Name Description Sequence
putative disease resistance protein SB1 putative disease resistance protein SB1 [Phaseolus vulgaris].

GGMGKTTIAKSICNEIRHEFKYKSYLANIREAWGGGRGPVDLQEQLLSDILKTKNKVHSTDWGKGKIKEMLCTKKVLVLLDDVSSVEQLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDCVHRVEKMNELESLELFSWHALRRADPCRDLFELSQEVVTYCGGLPLTL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF130
1-168 PTHR11017:SF130,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

GGMGKTTIAKSICNEIRHEFKYKSYLANIREAWGGGRGPVDLQEQLLSDILKTKNKVHSTDWGKGKIKEMLCTKKVLVLLDDVSSVEQLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDCVHRVEKMNELESLELFSWHALRRADPCRDLFELSQEVVTYCGGLPL

HMMPanther: PTHR11017
1-168 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGMGKTTIAKSICNEIRHEFKYKSYLANIREAWGGGRGPVDLQEQLLSDILKTKNKVHSTDWGKGKIKEMLCTKKVLVLLDDVSSVEQLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDCVHRVEKMNELESLELFSWHALRRADPCRDLFELSQEVVTYCGGLPL

superfamily: SSF52540
1-170 SSF52540

GGMGKTTIAKSICNEIRHEFKYKSYLANIREAWGGGRGPVDLQEQLLSDILKTKNKVHSTDWGKGKIKEMLCTKKVLVLLDDVSSVEQLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDCVHRVEKMNELESLELFSWHALRRADPCRDLFELSQEVVTYCGGLPLTL

HMMPfam: PF00931
IPR002182
1-170 NB-ARC,NBS
NB-ARC

GGMGKTTIAKSICNEIRHEFKYKSYLANIREAWGGGRGPVDLQEQLLSDILKTKNKVHSTDWGKGKIKEMLCTKKVLVLLDDVSSVEQLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDCVHRVEKMNELESLELFSWHALRRADPCRDLFELSQEVVTYCGGLPLTL

Gene3D: G3DSA:3.40.50.300
2-125 G3DSA:3.40.50.300

GMGKTTIAKSICNEIRHEFKYKSYLANIREAWGGGRGPVDLQEQLLSDILKTKNKVHSTDWGKGKIKEMLCTKKVLVLLDDVSSVEQLNDLCGNRDAIGEGSVIIITTRNVRLLREIGVDCVHR

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

MLCTKKVLVLLDDVS

FPrintScan: PR00364
IPR000767
163-170 DISEASERSIST
Disease resistance protein

CGGLPLTL


List of References

M I Rivkin, C E Vallejos, P E McClean
Disease-resistance related sequences in common bean.
Genome: 1999, 42(1);41-7
PubMed:10208000 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox