PRGDB00049210 (RPS2)

From PRG Wiki
Jump to: navigation, search
RPS2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 16306434 (AF420476)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Brassica nigra

Comment?

Brassica nigra NBS-LRR disease resistance protein RPS2-like protein (RPS2) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACACTGCTCACACAAATCAACAATAAATTTCTCAAGAAAAAGGATGCCTTTGTGATTTGGATTGTGGTTTCTAAGGAGCTACATATAAGAAATATTCAAGAAGAGATCGCGAAGAAACTAGGATTGGATGGGGAAGACTGGAACCGGAAAGATAAAGAGCAAAAGGCGTGTGAGATACATAGTGTCTTGAAGAGGAAGAAGTTTGTGTTGTTGTTGGATGACATATGGGAAAAAGTTAATCTAATGGAGATTGGAGTCCCTTACCCAACTAAAGAAAACAGATGCAAAGTAGTTTTCACCACTCGTTCTCTGGAAGTGTGTGGGCGCATGGGAGCTAATGTTGAGATTGCAGTCCAATGTTTGTCTCCTCATGATGCATTGGAGTTGTTCAAAAAGAAAGTTGGAGAGATCACATTAACAAGTCATCCAGAGATACCAGAGCTTGCGGCCATAGTTGCAAGAAAATGCCAAGGCCTCCCCCTCACCCTC


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein RPS2-like protein NBS-LRR disease resistance protein RPS2-like protein [Brassica nigra].

GGVGKTTLLTQINNKFLKKKDAFVIWIVVSKELHIRNIQEEIAKKLGLDGEDWNRKDKEQKACEIHSVLKRKKFVLLLDDIWEKVNLMEIGVPYPTKENRCKVVFTTRSLEVCGRMGANVEIAVQCLSPHDALELFKKKVGEITLTSHPEIPELAAIVARKCQGLPLTL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF119
1-99 PTHR23155:SF119,RFL1 (RPS5-LIKE 1)

GGVGKTTLLTQINNKFLKKKDAFVIWIVVSKELHIRNIQEEIAKKLGLDGEDWNRKDKEQKACEIHSVLKRKKFVLLLDDIWEKVNLMEIGVPYPTKEN

HMMPanther: PTHR23155
1-99 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLLTQINNKFLKKKDAFVIWIVVSKELHIRNIQEEIAKKLGLDGEDWNRKDKEQKACEIHSVLKRKKFVLLLDDIWEKVNLMEIGVPYPTKEN

superfamily: SSF52540
1-169 SSF52540

GGVGKTTLLTQINNKFLKKKDAFVIWIVVSKELHIRNIQEEIAKKLGLDGEDWNRKDKEQKACEIHSVLKRKKFVLLLDDIWEKVNLMEIGVPYPTKENRCKVVFTTRSLEVCGRMGANVEIAVQCLSPHDALELFKKKVGEITLTSHPEIPELAAIVARKCQGLPLTL

HMMPfam: PF00931
IPR002182
1-169 NB-ARC,NBS
NB-ARC

GGVGKTTLLTQINNKFLKKKDAFVIWIVVSKELHIRNIQEEIAKKLGLDGEDWNRKDKEQKACEIHSVLKRKKFVLLLDDIWEKVNLMEIGVPYPTKENRCKVVFTTRSLEVCGRMGANVEIAVQCLSPHDALELFKKKVGEITLTSHPEIPELAAIVARKCQGLPLTL

Gene3D: G3DSA:3.40.50.300
2-112 G3DSA:3.40.50.300

GVGKTTLLTQINNKFLKKKDAFVIWIVVSKELHIRNIQEEIAKKLGLDGEDWNRKDKEQKACEIHSVLKRKKFVLLLDDIWEKVNLMEIGVPYPTKENRCKVVFTTRSLEV

FPrintScan: PR00364
IPR000767
68-82 DISEASERSIST
Disease resistance protein

VLKRKKFVLLLDDIW

FPrintScan: PR00364
IPR000767
162-169 DISEASERSIST
Disease resistance protein

CQGLPLTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox