PRGDB00049211 (At1g61180; F11P17.10)

From PRG Wiki
Jump to: navigation, search
At1g61180; F11P17.10
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 15450875 (AY054518)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Similar to RPS-2 disease resistance protein (At1g61180; F11P17.10) mRNA, complete cds.

DNA Sequence

ATGGGGAGTTGTTTTTCTCTTCAAGTTAGTGATCAAACACTGAATCGTATCTTTAATTGCTTAATTGGTAAAAGTTATATTCGAACCCTCGAGAAGAATCTCAGAGCTCTGCAGAGGGAAATGGAAGATCTCAGAGCAATTCAACATGAGGTACAAAACAAGGTAGCTAGAGACGAGGCACGCCATCAACGAAGGCTTGAAGCTGTCCAGGTATGGCTTGACCGTGTCAATAGCGTTGATATAGAGTGCAAAGATCTGCTAAGTGTTACTCCTGTTGAGCTTCAAAAGTTGTGTCTATGCGGTTTGTGTTCAAAATATGTATGTTCAAGCTACAAATATGGGAAAAAGGTATTCTTGTTACTGGAAGAGGTTAAGAAACTAAACTCGGAGGGAAATTTTGACGAGGTTTCTCAGCCGCCTCCAAGGTCTGAAGTTGAAGAGAGGCCTACTCAGCCTACGATTGGTCAGGAAGACATGCTCGAAAAGGCATGGAACCGCCTTATGGAAGATGGAGTCGGAATCATGGGTCTGCACGGTATGGGTGGTGTAGGCAAAACAACCCTTTTCAAGAAAATCCACAACAAGTTCGCTGAAATAGGTGGTACGTTTGACATTGTGATCTGGATCGTGGTGTCTAAAGGCGTAATGATTTCAAAGCTTCAAGAAGATATTGCAGAGAAACTACACCTTTGTGACGACCTGTGGAAGAACAAGAATGAAAGTGATAAGGCCACTGATATACACAGAGTTTTAAAGGGCAAGAGATTTGTTTTGATGCTAGATGATATATGGGAGAAAGTGGATTTAGAGGCCATTGGTATTCCCTATCCGAGTGAAGTAAATAAATGCAAAGTAGCATTCACGACACGTTCTCGGGAAGTTTGTGGGGAGATGGGGGATCATAAGCCGATGCAAGTCAACTGTTTGGAACCAGAGGATGCATGGGAGCTGTTCAAAAACAAGGTCGGAGACAACACATTAAGTAGTGATCCTGTTATTGTGGAGTTGGCAAGAGAGGTCGCTCAAAAATGTCGTGGTCTGCCATTGGCGCTCAACGTCATTGGTGAGACAATGTCATCTAAAACTATGGTACAAGAATGGGAGCATGCAATCCATGTTTTTAATACATCCGCTGCAGAGTTTTCTGACATGCAAAACAAAATTCTTCCGATTCTCAAGTACAGCTACGATAGCTTGGGGGATGAACATATCAAGTCGTGTTTCCTATATTGTGCTCTGTTTCCTGAAGATGGTGAGATATATAACGAAAAGTTGATAGACTACTGGATATGCGAAGGATTCATCGGAGAAGACCAAGTTATAAAAAGAGCGAGGAATAAGGGTTATGCGATGCTCGGTACCCTTACCCGTGCAAATTTGCTAACAAAGGTTAGTACATATTATTGTGTGATGCATGACGTGGTTCGTGAAATGGCTTTATGGATTGCTTCCGATTTTGGGAAACAGAAAGAGAATTTTGTTGTGCAAGCAGGAGTCGGGTTACATGAAATACCAAAAGTCAAGGATTGGGGAGCTGTAAGAAAGATGTCATTAATGGATAATGATATTGAAGAGATAACATGCGAGTCCAAGTGTTCTGAACTTACAACTTTGTTCCTTCAAAGTAATAAATTGAAGAATCTACCAGGTGCATTCATTCGGTATATGCAAAAGCTAGTTGTTTTGGATCTTTCATATAATCGTGACTTCAATAAACTTCCAGAGCAGATATCGGGGCTGGTCTCGTTGCAGTTTCTTGACTTGTCGAATACAAGTATAGAGCACATGCCTATTGGTCTCAAAGAGTTGAAAAAGCTAACTTTCCTGGATTTGACTTATACTGATCGACTTTGTAGTATCAGTGGGATATCAAGGTTGTTGAGTTTAAGATTGTTGAGACTGCTAGGGTCTAAAGTTCATGGAGATGCTAGCGTATTGAAGGAGCTGCAGCAATTGCAGAATCTACAAGAGCTAGCCATAACTGTATCCGCGGAGTTAATTAGTTTGGATCAAAGGTTGGCGAAGTTAATCTCTAATCTTTGTATTGAAGGGTTTCTTCAAAAGCCATTCGATTTATCATTCTTGGCGAGTATGGAGAATCTTAGTTCCCTACGGGTGGAAAATAGTTATTTCTCGGAGATAAAGTGCAGAGAAAGCGAGACAGAATCGTCTTATTTACGCATCAATCCGAAAATTCCATGCTTTACCAACCTCTCACGACTGGAGATAATGAAGTGCCATAGCATGAAGGATCTGACTTGGATATTGTTTGCTCCAAATCTTGTCGTGCTACTCATTGAAGATTCAAGAGAAGTGGGAGAAATAATAAACAAAGAGAAAGCAACCAATCTTACAAGTATTACACCATTTCTGAAACTAGAATGGTTGATTTTGTATAATTTGCCGAAGCTGGAGAGTATCTACTGGAGTCCTCTCCCCTTTCCGGTTTTGTTGACCATGGATGTTTCAAACTGTCCAAAGCTGAGAAAGCTTCCATTAAATGCTACAAGTGTTTCAAAAGTTGAAGAATTTGAAATACATATGTATCCTCCTCCAGAACAGGAAAATGAGCTTGAATGGGAGGACGATGATACCAAAAATCGATTCTTGCCTTCAATCAAACCGTACAAGTACTTCGTCTACCCAGGAATGAGTTTCCTCACTGTCTAA


Protein sequences

Name Description Sequence
Similar to RPS-2 disease resistance protein Similar to RPS-2 disease resistance protein [Arabidopsis thaliana].

MGSCFSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLLLEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVSTYYCVMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPYKYFVYPGMSFLTV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-889 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLLLEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVSTYYCVMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPYKYFVYPGMSFLTV

HMMPanther: PTHR23155:SF117
5-889 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

FSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEARHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLLLEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVSTYYCVMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPYKYFVYPGMSFLTV

Coil: coil
27-55 coiled-coil

IRTLEKNLRALQREMEDLRAIQHEVQNKV

Seg: seg
115-127 seg

KKVFLLLEEVKKL

superfamily: SSF52540
135-369 P-loop containing nucleoside triphosphate hydrolases

EVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEH

HMMPfam: PF00931
IPR002182
156-438 NB-ARC,NBS
NB-ARC

QEDMLEKAWNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGDHKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSSKTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEIYNEKLIDYWICEGFIGED

Gene3D: G3DSA:3.40.50.300
164-264 no description

WNRLMEDGVGIMGLHGMGGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNESDKATDIHRVLKGKRFVLMLDDIW

Seg: seg
171-184 seg

GVGIMGLHGMGGVG

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

IMGLHGMGGVGKTTLF

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

VLKGKRFVLMLDDIW

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CRGLPLALNVIGETM

superfamily: SSF52058
470-848 L domain-like,LRR

VMHDVVREMALWIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSKVEEFEIHM

Gene3D: G3DSA:3.80.10.10
501-834 no description

LHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGLKELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAITVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESETESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEKATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLN

HMMPfam: PF13855
534-593 LRR_8,Leucine rich repeat

ELTTLFLQSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSI

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

RYMQKLVVLDLSYNRDF

Seg: seg
616-637 seg

RLCSISGISRLLSLRLLRLLGS

Seg: seg
648-658 seg

ELQQLQNLQEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox