PRGDB00049212 (Ve1)

From PRG Wiki
Jump to: navigation, search
Ve1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 14279667 (AF272366)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum verticillium wilt disease resistance protein (Ve1) mRNA, complete cds.

DNA Sequence

ATGAAAATGATGGCAACTCTGTACTTCCCTATGGTTCTCTTGATTCCCTCGTTTCAAATCTTATCAGGATACCACATTTTCTTGGTTTCCTCTCAATGCCTTGACGATCAAAAGTCATTGTTGCTGCAGTTTAAGGGAAGCCTCCAATATGATTCTACTTTGTCAAAGAAATTGGCAAAATGGAACGACATGACAAGTGAATGTTGCAATTGGAATGGGGTTACATGCAATCTCTTTGGTCATGTCATCGCTTTGGAACTGGATGATGAGACTATTTCTAGTGGAATTGAGAATTCTAGTGCACTTTTCAGTCTTCAATATCTTGAGAGCCTAAATTTGGCTGACAACATGTTCAATGTTGGCATACCAGTTGGTATAGACAACCTCACAAACTTGAAGTACCTGAATTTATCCAATGCTGGTTTTGTCGGGCAAATTCCTATAACATTATCAAGATTAACAAGGCTAGTTACTCTTGATCTCTCAACTATTCTCCCTTTTTTTGATCAGCCACTTAAACTTGAGAATCCCAATTTGAGTCATTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGGGTTGATCTTTCGTCTCAGAGGTCTGAGTGGTGTCAATCTTTATCTTTACATTTGCCTAACTTGACCGTTTTGAGCTTGCGTGATTGTCAAATTTCAGGCCCTTTGGATGAATCACTTACTAAGCTTCACTTTCTCTCTTTTGTCCAACTTGACCAGAACAATCTCTCTAGCACAGTTCCTGAATATTTTGCCAATTTCTCGAACTTGACTACATTGACCCTGGGCTCTTGTAATCTACAGGGAACATTTCCTGAAAGAATCTTTCAGGTATCAGTTTTAGAGAGTTTGGACTTGTCAATTAACAAGTTGCTTCGTGGTAGTATTCCAATTTTTTTCCGAAATGGATCTCTGAGGAGGATATCACTAAGCTACACCAACTTTTCCGGTTCATTACCAGAGTCCATTTCGAACCATCAAAATCTATCCAGGTTAGAGCTTTCTAATTGCAATTTCTATGGATCAATACCTTCCACAATGGCAAACCTTAGAAATCTTGGTTATTTGGATTTCTCCTTCAACAATTTCACTGGTTCTATCCCATATTTTCGACTGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAGCTTGTCCACATTAATTTAGGGAACAATTTACTCAGCGGGAGCCTTCCTGCATATATATTTGAGCTCCCCTCGTTGCAGCAGCTTTTTCTTTACAGAAATCAATTTGTTGGCCAAGTCGACGAATTTCGCAATGCATCCTCCTCTCCGTTGGATACAGTTGACTTGACAAACAACCACCTGAATGGATCGATTCCGAAGTCCATGTTTGAAATTGAAAGGCTTAAGGTGCTCTCACTTTCTTCCAACTTCTTTAGAGGGACAGTGCCCCTTGACCTCATTGGGAGGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAAGTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGTTGAACATATTGAAATTAGCGTCTTGTCGGCTGCAAAAGTTCCCCGATCTCAAGAATCAGTCATGGATGATGCACTTAGACCTTTCAGACAACCAAATATTGGGGGCAATACCAAATTGGATCTGGGGAATTGGTGGTGGAGGTCTCACCCACCTGAATCTTTCATTCAATCAGCTGGAGTACGTGGAACAGCCTTACACTGCTTCCAGCAATCTTGTAGTCCTTGATTTGCATTCCAACCGTTTAAAAGGTGACTTACTAATACCACCTTGCACTGCCATCTATGTGAACTACTCTAGCAATAATTTAAACAATTCCATCCCAACAGATATTGGAAAGTCTCTTGGTTTTGCCTCCTTTTTCTCGGTAGCAAACAATGGCATTACTGGAATAATTCCTGAATCCATATGCAACTGCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTACTGGAATATAGTACAAAACTTGGAGTGCTGAATCTTGGGAACAATAAACTCAATGGTGTTATACCAGATTCATTTTCAATTGGTTGTGCTCTACAAACATTAGACCTCAGTGCGAATAACTTACAAGGCAGGCTGCCAAAATCGATTGTGAATTGTAAGTTGTTGGAGGTCCTGAATGTTGGAAATAACAGACTTGTTGATCATTTCCCATGCATGTTGAGGAACTCAAACAGTCTGAGGGTCCTAGTCTTGCGCTCCAATAAATTCTATGGAAATCTTATGTGTGATGTAACCAGAAATAGCTGGCAGAATCTCCAGATCATAGATATAGCTTCCAACAACTTCACTGGTGTGTTGAATGCAGAATTCTTTTCAAATTGGAGAGGAATGATGGTTGCAGATGATTACGTGGAGACAGGACGCAATCATATCCAGTATGAGTTCTTACAACTAAGTAAATTGTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCCAATAGATTTCAAGGAGCGATACCAGATGCTATCGGGAATCTCAGCTCACTTTATGTTCTGAATCTGTCACACAATGCCCTTGAGGGACCAATCCCAAAATCGATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGGGAGATCCCATCAGAGCTTGCAAGTCTCACATTCTTAGCAGCTTTGAACTTATCGTTCAACAAATTGTTTGGCAAAATTCCATCAACTAATCAGTTTCAAACATTCTCAGCAGATTCCTTTGAAGGAAACAGTGGCCTATGCGGGCTCCCTCTCAACAACAGTTGTCAAAGCAATGGCTCAGCCTCAGAGTCCCTGCCTCCACCAACTCCGCTACCAGACTCAGATGATGAATGGGAGTTCATTTTTGCAGCAGTTGGATACATAGTAGGGGCAGCAAATACTATTTCAGTTGTGTGGTTTTACAAGCCAGTGAAGAAATGGTTTGATAAGCATATGGAGAAATGCTTGCTTTGGTTTTCAAGAAAGTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Lycopersicon esculentum].

MKMMATLYFPMVLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNKLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSCQSNGSASESLPPPTPLPDSDDEWEFIFAAVGYIVGAANTISVVWFYKPVKKWFDKHMEKCLLWFSRK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-986 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MKMMATLYFPMVLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNKLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

HMMPanther: PTHR24420
1-986 FAMILY NOT NAMED,FAMILY NOT NAMED

MKMMATLYFPMVLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNKLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
32-211 no description

QCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLS

HMMPfam: PF08263
IPR013210
35-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCN

superfamily: SSF52047
62-308 RNI-like,LRR

NDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFF

HMMSmart: SM00369
IPR003591
129-153 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLKYLNLSNAGFVGQIPITLSRL

Gene3D: G3DSA:3.80.10.10
213-454 no description

HLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNAS

HMMSmart: SM00369
IPR003591
214-237 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPNLTVLSLRDCQISGPLDESLTK

HMMPfam: PF13516
214-229 LRR_6,Leucine Rich repeat

LPNLTVLSLRDCQISG

HMMSmart: SM00369
IPR003591
238-261 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LHFLSFVQLDQNNLSSTVPEYFAN

HMMSmart: SM00369
IPR003591
262-286 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FSNLTTLTLGSCNLQGTFPERIFQV

superfamily: SSF52058
274-646 L domain-like,LRR

NLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNKLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGK

HMMPfam: PF13855
383-442 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQ

FPrintScan: PR00019
384-397 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

HMMSmart: SM00369
IPR003591
406-430 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSELVHINLGNNLLSGSLPAYIFEL

Seg: seg
413-423 seg

NLGNNLLSGSL

Gene3D: G3DSA:3.80.10.10
458-646 no description

LDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNKLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGK

HMMSmart: SM00369
IPR003591
504-527 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLSRLELSYNKLTVDASSSNST

Seg: seg
573-581 seg

WIWGIGGGG

superfamily: SSF52058
624-986 L domain-like,LRR

CTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

Seg: seg
630-639 seg

NYSSNNLNNS

Gene3D: G3DSA:3.80.10.10
654-730 no description

FSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLS

HMMPfam: PF13855
656-710 LRR_8,Leucine rich repeat

VANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKL

Seg: seg
699-713 seg

KLGVLNLGNNKLNGV

HMMPfam: PF13855
724-781 LRR_8,Leucine rich repeat

LQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNK

Gene3D: G3DSA:3.80.10.10
731-983 no description

ANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLN

HMMPfam: PF13855
873-929 LRR_8,Leucine rich repeat

SIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

FPrintScan: PR00019
892-905 LEURICHRPT,Leucine-rich repeat signature

LSSLYVLNLSHNAL

HMMSmart: SM00369
IPR003591
892-915 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLYVLNLSHNALEGPIPKSIGK

HMMSmart: SM00369
IPR003591
916-944 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQMLESLDLSTNHLSGEIPSELASLTFLA

Seg: seg
993-1008 seg

SESLPPPTPLPDSDDE


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox