PRGDB00049213 (Ve2)

From PRG Wiki
Jump to: navigation, search
Ve2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 14269078 (AF365930)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum verticillium wilt disease resistance protein Ve2 (Ve2) mRNA, complete cds.

DNA Sequence

ATGAGATTTTTACACTTTCTATGGATCTTCTTCATCATACCCTTTTTGCAAATTTTATTAGGTAATGAGATTTTATTGGTTTCCTCTCAATGTCTTGATGATCAAAAGTCATTGTTGCTGCAGTTGAAGGGCAGCTTCCAATATGATTCTACTTTGTCAAATAAATTGGCAAGATGGAACCACAACACAAGTGAATGTTGTAACTGGAATGGGGTTACATGTGACCTCTCTGGTCATGTGATTGCCTTGGAACTGGATGATGAGAAAATTTCTAGTGGAATTGAGAATGCAAGTGCTCTTTTCAGTCTTCAGTATCTTGAGAGGCTAAATTTGGCTTACAACAAGTTCAATGTTGGCATACCAGTTGGTATAGGCAACCTCACCAACTTGACGTACCTGAATTTATCCAATGCCGGTTTTGTTGGCCAAATTCCTATGATGTTATCAAGGTTAACAAGGCTAGTTACTCTTGATCTCTCAACTCTTTTCCCTGACTTTGCCCAGCCACTAAAACTAGAGAATCCCAATTTGAGTCATTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGGGTTGATCTCTCAGCTCAGAGGACTGAGTGGTGTCAATCTTTATCTTCATATTTGCCTAACTTGACTGTCTTGAGCTTGCGTACTTGTCGAATTTCAGGCCCTATTGATGAATCACTTTCTAAGCTTCACTTTCTCTCTTTCATCCGTCTTGACCAGAACAATCTCTCTACCACAGTTCCTGAATACTTTGCCAATTTCTCAAACTTGACTACCTTGACCCTCTCCTCTTGTAATCTGCAAGGAACATTTCCTAAAAGAATCTTTCAGGTACCAGTCTTAGAGTTTTTGGACTTGTCAACTAACAAATTGCTTAGTGGTAGTATTCCGATTTTTCCTCAAATTGGATCATTGAGGACGATATCACTAAGCTACACCAAGTTTTCTGGTTCATTACCAGACACCATTTCGAACCTTCAAAACCTATCCAGGTTAGAACTCTCCAACTGCAATTTCAGTGAACCAATACCTTCCACAATGGCGAACCTTACCAATCTTGTTTATTTAGATTTCTCCTTCAACAATTTCACTGGTTCCCTCCCATATTTCCAAGGGGCCAAGAAACTCATCTACTTGGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAACTTGTCTACATTAATTTAGGGAACAATTCACTCAACGGGAGCCTTCCTGCATATATATTTGAGCTCCCCTCGTTGAAGCAGCTTTTTCTTTACAGCAATCAATTTGTTGGCCAAGTCGACGAATTTCGCAATGCATCCTCCTCTCCGTTGGATACAGTTGACTTGAGAAACAACCACCTGAATGGATCGATTCCCAAGTCCATGTTTGAAGTTGGGAGGCTTAAGGTCCTCTCACTTTCTTCCAACTTCTTTAGAGGGACAGTTCCCCTTGACCTCATTGGGAGGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGTTGAACATATTGAAATTAGCGTCTTGTCGGCTGCAAAAGTTCCCCGATCTCAAGAATCAGTCAAGGATGATGCACTTAGACCTTTCAGACAACCAAATATTGGGGGCAATACCAAATTGGATCTGGGGAATTGGTGGTGGAGGTCTCGCCCACCTGAATCTTTCATTCAATCAGCTGGAGTACGTGGAACAGCCTTACACTGTTTCCAGCAATCTTGTAGTCCTTGATTTGCATTCCAACCGTTTAAAAGGTGACTTACTAATACCACCTTCCACTGCCATCTATGTGGACTACTCGAGCAATAATTTAAACAATTCCATCCCAACAGATATTGGAAGATCTCTTGGTTTTGCCTCCTTTTTCTCGGTAGCAAACAATAGCATCACTGGAATAATTCCTGAATCCATATGCAACGTCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTACTGGAATATAGTCCAAAACTTGGAGTGCTGAATCTAGGGAACAATAGACTCCATGGTGTTATACCAGATTCATTTCCAATTGGTTGTGCTCTAATAACTTTAGACCTCAGCAGGAATATCTTTGAAGGGAAGCTACCAAAATCGCTTGTCAACTGCACGTTGTTGGAGGTCCTGAATGTTGGAAATAACAGTCTTGTTGATCGTTTCCCATGCATGTTGAGGAACTCAACCAGCCTGAAGGTCCTAGTCTTGCGCTCCAATAAATTCAATGGAAATCTTACGTGTAATATAACCAAACATAGCTGGAAGAATCTCCAGATCATAGATATAGCTTCCAACAATTTTACTGGTATGTTGAATGCAGAATGCTTTACAAATTGGAGAGGAATGATGGTTGCAAAAGATTACGTGGAGACAGGACGCAATCATATCCAGTATGAGTTCTTACAACTAAGTAACTTGTACTATCAGGATACAGTGACATTAATCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTTAGGGTCTTCACATCTATTGATTTCTCTTCCAATAGATTTCAAGGAAAGATACCAGATACTGTTGGGGATCTTAGCTCACTTTATGTTTTGAACCTGTCACACAATGCCCTCGAGGGACCAATTCCAAAATCAATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAAGAAACCACCTGTCCGGGGAGATCCCCTCAGAGCTTTCAAGTCTCACATTCTTAGCAGTTTTGAACTTATCGTTCAACAATTTGTTTGGAAAAATCCCGCAAAGTAATCAATTTGAAACATTCTCAGCAGAATCCTTTGAAGGAAACAGAGGCCTATGCGGGCTCCCTCTTAACGTCATTTGCAAAAGCGATACTTCAGAGTTGAAACCAGCACCAAGTTCTCAAGATGACTCTTATGATTGGCAGTTCATATTTACGGGTGTGGGATATGGAGTAGGGGCAGCAATCTCCATTGCACCTCTGTTGTTTTACAAGCAAGGAAACAAATACTTTGACAAACATTTGGAGAGAATGCTTAAACTGATGTTTCCTAGATACTGGTTCAGTTACACCAGATTTGACCCTGGGAAGGTTGTGGCTGTGGAACACTATGAAGATGAGACCCCAGATGACACCGAAGATGACGATGAGGGTGGAAAAGAAGCATCTCTTGGGCGTTATTGTGTCTTCTGTAGTAAACTTGATTTTCAGAAAAATGAAGCAATGCATGATCCAAAATGCACTTGTCATATGTCATCATCCCCCAATTCTTTTCCTCCTACGCCGTCCTTTTTTTCACCTTTATTAGTCATATATCACAAAAAGTTTTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein Ve2 verticillium wilt disease resistance protein Ve2 [Lycopersicon esculentum].

MRFLHFLWIFFIIPFLQILLGNEILLVSSQCLDDQKSLLLQLKGSFQYDSTLSNKLARWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLERLNLAYNKFNVGIPVGIGNLTNLTYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFAQPLKLENPNLSHFIENSTELRELYLDGVDLSAQRTEWCQSLSSYLPNLTVLSLRTCRISGPIDESLSKLHFLSFIRLDQNNLSTTVPEYFANFSNLTTLTLSSCNLQGTFPKRIFQVPVLEFLDLSTNKLLSGSIPIFPQIGSLRTISLSYTKFSGSLPDTISNLQNLSRLELSNCNFSEPIPSTMANLTNLVYLDFSFNNFTGSLPYFQGAKKLIYLDLSRNGLTGLLSRAHFEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQFVGQVDEFRNASSSPLDTVDLRNNHLNGSIPKSMFEVGRLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSRMMHLDLSDNQILGAIPNWIWGIGGGGLAHLNLSFNQLEYVEQPYTVSSNLVVLDLHSNRLKGDLLIPPSTAIYVDYSSNNLNNSIPTDIGRSLGFASFFSVANNSITGIIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSPKLGVLNLGNNRLHGVIPDSFPIGCALITLDLSRNIFEGKLPKSLVNCTLLEVLNVGNNSLVDRFPCMLRNSTSLKVLVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFSAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISIAPLLFYKQGNKYFDKHLERMLKLMFPRYWFSYTRFDPGKVVAVEHYEDETPDDTEDDDEGGKEASLGRYCVFCSKLDFQKNEAMHDPKCTCHMSSSPNSFPPTPSFFSPLLVIYHKKF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
6-1029 PTHR24420,FAMILY NOT NAMED

FLWIFFIIPFLQILLGNEILLVSSQCLDDQKSLLLQLKGSFQYDSTLSNKLARWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLERLNLAYNKFNVGIPVGIGNLTNLTYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFAQPLKLENPNLSHFIENSTELRELYLDGVDLSAQRTEWCQSLSSYLPNLTVLSLRTCRISGPIDESLSKLHFLSFIRLDQNNLSTTVPEYFANFSNLTTLTLSSCNLQGTFPKRIFQVPVLEFLDLSTNKLLSGSIPIFPQIGSLRTISLSYTKFSGSLPDTISNLQNLSRLELSNCNFSEPIPSTMANLTNLVYLDFSFNNFTGSLPYFQGAKKLIYLDLSRNGLTGLLSRAHFEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQFVGQVDEFRNASSSPLDTVDLRNNHLNGSIPKSMFEVGRLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSRMMHLDLSDNQILGAIPNWIWGIGGGGLAHLNLSFNQLEYVEQPYTVSSNLVVLDLHSNRLKGDLLIPPSTAIYVDYSSNNLNNSIPTDIGRSLGFASFFSVANNSITGIIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSPKLGVLNLGNNRLHGVIPDSFPIGCALITLDLSRNIFEGKLPKSLVNCTLLEVLNVGNNSLVDRFPCMLRNSTSLKVLVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFSAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISIAPLLFYKQ

HMMPanther: PTHR24420:SF473
6-1029 PTHR24420:SF473,SUBFAMILY NOT NAMED

FLWIFFIIPFLQILLGNEILLVSSQCLDDQKSLLLQLKGSFQYDSTLSNKLARWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLERLNLAYNKFNVGIPVGIGNLTNLTYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFAQPLKLENPNLSHFIENSTELRELYLDGVDLSAQRTEWCQSLSSYLPNLTVLSLRTCRISGPIDESLSKLHFLSFIRLDQNNLSTTVPEYFANFSNLTTLTLSSCNLQGTFPKRIFQVPVLEFLDLSTNKLLSGSIPIFPQIGSLRTISLSYTKFSGSLPDTISNLQNLSRLELSNCNFSEPIPSTMANLTNLVYLDFSFNNFTGSLPYFQGAKKLIYLDLSRNGLTGLLSRAHFEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQFVGQVDEFRNASSSPLDTVDLRNNHLNGSIPKSMFEVGRLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSRMMHLDLSDNQILGAIPNWIWGIGGGGLAHLNLSFNQLEYVEQPYTVSSNLVVLDLHSNRLKGDLLIPPSTAIYVDYSSNNLNNSIPTDIGRSLGFASFFSVANNSITGIIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSPKLGVLNLGNNRLHGVIPDSFPIGCALITLDLSRNIFEGKLPKSLVNCTLLEVLNVGNNSLVDRFPCMLRNSTSLKVLVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFSAESFEGNRGLCGLPLNVICKSDTSELKPAPSSQDDSYDWQFIFTGVGYGVGAAISIAPLLFYKQ

superfamily: SSF52058
29-200 SSF52058,LRR

SQCLDDQKSLLLQLKGSFQYDSTLSNKLARWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLERLNLAYNKFNVGIPVGIGNLTNLTYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFAQPLKLENPNLSHFIENSTELRELYLDGVDLSAQ

Gene3D: G3DSA:3.80.10.10
30-303 G3DSA:3.80.10.10

QCLDDQKSLLLQLKGSFQYDSTLSNKLARWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLERLNLAYNKFNVGIPVGIGNLTNLTYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFAQPLKLENPNLSHFIENSTELRELYLDGVDLSAQRTEWCQSLSSYLPNLTVLSLRTCRISGPIDESLSKLHFLSFIRLDQNNLSTTVPEYFANFSNLTTLTLSSCNLQGTFPKRIFQVPVLEFLDLSTNKLLSGSIP

HMMPfam: PF08263
IPR013210
33-75 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQKSLLLQLKGSFQYDSTLSNKLARWNHNTSECCNWNGVTCD

superfamily: SSF52047
176-441 SSF52047,LRR

NLSHFIENSTELRELYLDGVDLSAQRTEWCQSLSSYLPNLTVLSLRTCRISGPIDESLSKLHFLSFIRLDQNNLSTTVPEYFANFSNLTTLTLSSCNLQGTFPKRIFQVPVLEFLDLSTNKLLSGSIPIFPQIGSLRTISLSYTKFSGSLPDTISNLQNLSRLELSNCNFSEPIPSTMANLTNLVYLDFSFNNFTGSLPYFQGAKKLIYLDLSRNGLTGLLSRAHFEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQF

HMMPfam: PF13855
239-297 LRR_8,Leucine rich repeat

LSFIRLDQNNLSTTVPEYFANFSNLTTLTLSSCNLQGTFPKRIFQVPVLEFLDLSTNKL

Gene3D: G3DSA:3.80.10.10
305-519 G3DSA:3.80.10.10

FPQIGSLRTISLSYTKFSGSLPDTISNLQNLSRLELSNCNFSEPIPSTMANLTNLVYLDFSFNNFTGSLPYFQGAKKLIYLDLSRNGLTGLLSRAHFEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQFVGQVDEFRNASSSPLDTVDLRNNHLNGSIPKSMFEVGRLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDA

HMMPfam: PF13855
310-369 LRR_8,Leucine rich repeat

SLRTISLSYTKFSGSLPDTISNLQNLSRLELSNCNFSEPIPSTMANLTNLVYLDFSFNNF

HMMPfam: PF13855
381-440 LRR_8,Leucine rich repeat

KLIYLDLSRNGLTGLLSRAHFEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQ

FPrintScan: PR00019
382-395 LEURICHRPT,Leucine-rich repeat signature

LIYLDLSRNGLTGL

superfamily: SSF52058
401-616 SSF52058,LRR

FEGLSELVYINLGNNSLNGSLPAYIFELPSLKQLFLYSNQFVGQVDEFRNASSSPLDTVDLRNNHLNGSIPKSMFEVGRLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSRMMHLDLSDNQILGAIPNWIWGIGGGGLAHLNLSFNQLEYVEQPYTVSSNLVVLDLHSNRLKGD

Gene3D: G3DSA:3.80.10.10
527-716 G3DSA:3.80.10.10

FTFPQLNILKLASCRLQKFPDLKNQSRMMHLDLSDNQILGAIPNWIWGIGGGGLAHLNLSFNQLEYVEQPYTVSSNLVVLDLHSNRLKGDLLIPPSTAIYVDYSSNNLNNSIPTDIGRSLGFASFFSVANNSITGIIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSPKLGVLNLGNNRLHGVIPDSF

superfamily: SSF52058
622-984 SSF52058,LRR

STAIYVDYSSNNLNNSIPTDIGRSLGFASFFSVANNSITGIIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSPKLGVLNLGNNRLHGVIPDSFPIGCALITLDLSRNIFEGKLPKSLVNCTLLEVLNVGNNSLVDRFPCMLRNSTSLKVLVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFSAESFEGNRGLCGLPLNVIC

HMMPfam: PF13855
654-708 LRR_8,Leucine rich repeat

VANNSITGIIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSPKLGVLNLGNNRL

Gene3D: G3DSA:3.80.10.10
722-980 G3DSA:3.80.10.10

LITLDLSRNIFEGKLPKSLVNCTLLEVLNVGNNSLVDRFPCMLRNSTSLKVLVLRSNKFNGNLTCNITKHSWKNLQIIDIASNNFTGMLNAECFTNWRGMMVAKDYVETGRNHIQYEFLQLSNLYYQDTVTLIIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPSELSSLTFLAVLNLSFNNLFGKIPQSNQFETFSAESFEGNRGLCGLPL

HMMPfam: PF13855
871-927 LRR_8,Leucine rich repeat

SIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHL

FPrintScan: PR00019
914-927 LEURICHRPT,Leucine-rich repeat signature

LQMLESLDLSRNHL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox