PRGDB00049214 (disease resistance protein RPS2)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPS2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13661830 (AF368301)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPS2 gene, complete cds.

DNA Sequence

ATGGATTTCATCTCATCTCTTATCGTTGGCTGTGCTCAGGTGTTGTGTGAATCTATGAATATGGCGGAGAGAAGAGGACATAAGACTGATCTTAGACAAGCCATCACTGATCTTGAAACAGCCATCGGTGACTTGAAGGCCGTACGTGATGACCTGACTTTACGGATCCAACAAGACGGTCTAGAGGGACGAAGCTGCTCAAATCGTGCCAGAGAGTGGCTTAGTGCGGTGCAAGTAACGGAGACTAAAACAGCCCTACTTTTAGTGAGGTTTAGGCGTCGGGAACAGAGGACGCGAATGAGGAGGAGATGCCTCAGTTGTTTCGGTTGTGCCGACTACAAACTGTGCAAGAAGGTTTCTGCCATATTGAAGAGCATTGGTGAGCTGAGAGAACGCTCTGAAGCTATCAAAACAGATGGCGGGTCCATTCAAGTAACTTGTAGAGAGATACCCATCAAGTCCGTTGTCGGAAATACCACGATGATGGAACAGGTTTTGGAATTTCTCAGTGAAGAAGAAGAAAGAGGAATCATTGGTGTTTATGGACCTGGTGGGGTTGGGAAGACAACGTTAATGCAGAGCATTAACAACGAGCTGATCACAAAAGGACATCAGTATGATGTACTGATTTGGGTTCAAATGTCCAGAGAATTCGGCGAGTGTACAATTCAGCAAGCCGTTGGAGCACGGTTGGGTTTATCTTGGGACGAGAAGGAGACCGGCGAAAACAGAGCTTTGAAGATATACAGAGCTTTGAGACAGAAACGTTTCTTGTTGTTGCTAGATGATGTCTGGGAAGAGATAGACTTGGAGAAAACTGGAGTTCCTCGACCTGACAGGGAAAACAAATGCAAGGTGATGTTCACGACACGGTCTATAGCATTATGCAACAATATGGGTGCGGAATACAAGTTGAGAGTGGAGTTTCTGGAGAAGAAACACGCGTGGGAGCTGTTCTGTAGTAAGGTATGGAGAAAAGATCTTTTAGAGTCATCATCAATTCGCCGGCTCGCGGAGATTATAGTGAGTAAATGTGGAGGATTGCCACTAGCGTTGATCACTTTAGGAGGAGCCATGGCTCATAGAGAGACTGAAGAAGAGTGGATCCATGCTAGTGAAGTTCTGACTAGATTTCCAGCAGAGATGAAGGGTATGAACTATGTATTTGCCCTTTTGAAATTCAGCTACGACAACCTCGAGAGTGATCTGCTTCGGTCTTGTTTCTTGTACTGTGCTTTATTCCCTGAAGAACATCCTATAGAGATCGAGCAGCTTGTTGAGTACTGGGTCGGCGAAGGGTTTCTCACCAGTTCCAATGGCGTTAACACCATTTACAAGGGATATTTTCTCATTGGGGACCTGAAAGCGGCATGCTTGTTGGAAACCGGAGATGAGAAAACACAGGTGAAGATGTATAATGTGGTCAGAAGCTTTGCACTATGGATGGCATCTGAACAAGGGACTTATAAGGAGCTGATCCTAGTTGAGCCTAGCATGGGACATACTGAAGCTCCTAAAGCAGAAAACTGGCGACAAGCGTTGGTGATTTCATTGTTAGATAACAGAATTCAGACCTTGCCTGAAAAACTCATATGCCCGAAACTGACAACACTGATGCTCCAACAGAACAGCTATTTGAAGAAGATTCCAACAGGGTTTTTCATGCATATGCCTGTTCTCAGAGTCTTGGACTTGTCTTTCACAAGTATCACTGAGATTCCGTTGTCTATCAAGTATTTGGTGGAGTTGTATCATCTGTCTATGTCAGGAACAAAGATAAGTGTATTGCCACAGGAGCTTGGGAATCTTAGAAAGCTGAAGCATCTGGACCTACAAAGAACTCAGTTTCTTCAGACGATCCCACGAGATGCCATATGTTGGCTGAGCAAGCTCGAGGTTCTGAACTTGTACTACAGTTACGCGGGATGGGGACTGCAGAGCTTTCAAGAAGATGAAGTAGAAGAACTCGGATTCGCTGACTTGGAATACTTGGAAAACCTAACCACACTCGGTATCACTGTTCTCTCATTGGAGACCCTAAAAACTCTCTTCGAGTTCGGTGCTTTGCATAAACATATACAGCATCTCCACGTTGAAGAGTGCAATGATCTCCTCTACTTCAATCTCCCATCACTCACTAACCATGGCAGGAACCTGAGAAGACTTAGCATTAAAAGTTGCCATGACTTGGAGTACCTGGTCACACCCGCAGATTTTGAAAATGATTGGCTTCCGAGTCTAGAGGTTCTGACGTTACACAGCCTTCACAACTTAACCAGAGTGTGGGGAAATTCTGTAAGCCAAGATTGTCTGCGGAATATCCGTTGCATAAACATTTCACACTGCAACAAGCTGAAGAATGTCTCATGGGTTCAGAAACTCCCAAAGCTAGAGGTGATTGAACTGTTCGACTGCAGAGAGATAGAGGAATTGATAAGCGAACACGAGAGTCCATCCGTCGAAGATCCAACATTGTTCCCAAGCCTGAAGACCTTGACAACTAGGGATCTGCCAGAACTAAACAGCATCCTCCCATCTCGATTTTCATTCCAAAAAGTTGAAACATTAGTCATCACAAATTGCCCCAGAGTTAAGAAACTGCCGTTTCAGGAGAGGAGGACCCAGATGAACTTGCCAACAGTTTATTGTGAGGAGAAATGGTGGAAAGCACTGGAAAAAGATCAACCAAACGAAGAGCTTTGTTATTTACCGCGCTTTGTTCCAAATTGA


Protein sequences

Name Description Sequence
disease resistance protein RPS2 disease resistance protein RPS2 [Arabidopsis thaliana].

MDFISSLIVGCAQVLCESMNMAERRGHKTDLRQAITDLETAIGDLKAVRDDLTLRIQQDGLEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRCLSCFGCADYKLCKKVSAILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHPIEIEQLVEYWVGEGFLTSSNGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMYNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSYLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWGLQSFQEDEVEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLTTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCEEKWWKALEKDQPNEELCYLPRFVPN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-909 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QVLCESMNMAERRGHKTDLRQAITDLETAIGDLKAVRDDLTLRIQQDGLEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRCLSCFGCADYKLCKKVSAILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHPIEIEQLVEYWVGEGFLTSSNGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMYNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSYLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWGLQSFQEDEVEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLTTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCEEKWWKALEKDQPNEELCYLPRFVPN

HMMPanther: PTHR23155:SF105
13-909 PTHR23155:SF105,RPS2 (RESISTANT TO P. SYRINGAE 2)

QVLCESMNMAERRGHKTDLRQAITDLETAIGDLKAVRDDLTLRIQQDGLEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRCLSCFGCADYKLCKKVSAILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHPIEIEQLVEYWVGEGFLTSSNGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMYNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSYLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWGLQSFQEDEVEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLTTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCEEKWWKALEKDQPNEELCYLPRFVPN

superfamily: SSF52540
138-382 SSF52540

TDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEM

Gene3D: G3DSA:3.40.50.300
148-265 G3DSA:3.40.50.300

REIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVW

HMMPfam: PF00931
IPR002182
159-439 NB-ARC,NBS
NB-ARC

TTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHPIEIEQLVEYWVGEGFLTSSN

HMMSmart: SM00382
IPR003593
174-311 AAA,NBS
AAA+ ATPase domain

ERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLE

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

IIGVYGPGGVGKTTLM

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

ALRQKRFLLLLDDVW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CGGLPLALITLGGAM

superfamily: SSF52058
470-884 SSF52058,LRR

KMYNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSYLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWGLQSFQEDEVEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLTTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCE

Gene3D: G3DSA:3.80.10.10
508-638 G3DSA:3.80.10.10

ENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSYLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYY

HMMPfam: PF13855
533-593 LRR_8,Leucine rich repeat

PKLTTLMLQQNSYLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKI

FPrintScan: PR00364
IPR000767
601-617 DISEASERSIST
Disease resistance protein

GNLRKLKHLDLQRTQFL

Gene3D: G3DSA:3.80.10.10
692-865 G3DSA:3.80.10.10

HIQHLHVEECNDLLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLTTRDLPELNSILPSRFSFQKVETLVITNCPRVK


List of References

D Banerjee, X Zhang, A F Bent
The leucine-rich repeat domain can determine effective interaction between RPS2 and other host factors in arabidopsis RPS2-mediated disease resistance.
Genetics: 2001, 158(1);439-50
PubMed:11333251 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox