PRGDB00049215 (Rccn3)

From PRG Wiki
Jump to: navigation, search
Rccn3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 11991254 (AF320848)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum putative NBS-LRR disease resistance protein RCCN3 (Rccn3) gene, partial cds.

DNA Sequence

TGATACTGGATGATGTCTGGTGCAACAAGGATGTTGGTGAGCAGAATCTGCCACAATTACTTTCTTCATTCAAGGTTGGAAAGAGAGGAAGCAAGATCCTAGCGACAAGTCGAAATGTAGATGCCTTCTCTGATCTTGGTCCTGATGTGAGATGTGCCAATTTTCCAATTAGTGACTTGGATGATAGTATGTTCCTTGAGCTATTCATGTATTATGCACTTGGAGATTGGAATGCAAACAATGGAGCTGGGAGCACACTCTGGAATATTGGGGCCCACATTGCAGAAAAGCTTAAGAGGTCACCTCTAGCAGCCAGTACAGTGGGAGGACAACTACGTACAAGAAAAAATGTTGAGTTTTGGAGAAGAGCTAGGGATCAGGACTTATTGAACGAGACAATGGGAGCTCTGTCATGGAGCTACCAGCATCTTAATGCGCAGATTAGACAATGCTTTGCTTACTGTAGTATGTTCCCCAGAGGACATTGTTTCAAACGTCATGTGTTACTTAAGTTGTGGGTGGCAGAAGGGTTCATAAGAAGCAC


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein RCCN3 putative NBS-LRR disease resistance protein RCCN3 [Triticum aestivum].

ILDDVWCNKDVGEQNLPQLLSSFKVGKRGSKILATSRNVDAFSDLGPDVRCANFPISDLDDSMFLELFMYYALGDWNANNGAGSTLWNIGAHIAEKLKRSPLAASTVGGQLRTRKNVEFWRRARDQDLLNETMGALSWSYQHLNAQIRQCFAYCSMFPRGHCFKRHVLLKLWVAEGFIRST


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-179 NB-ARC,NBS
NB-ARC

ILDDVWCNKDVGEQNLPQLLSSFKVGKRGSKILATSRNVDAFSDLGPDVRCANFPISDLDDSMFLELFMYYALGDWNANNGAGSTLWNIGAHIAEKLKRSPLAASTVGGQLRTRKNVEFWRRARDQDLLNETMGALSWSYQHLNAQIRQCFAYCSMFPRGHCFKRHVLLKLWVAEGFIR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox