PRGDB00049217 (Rccn4)

From PRG Wiki
Jump to: navigation, search
Rccn4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 11991249 (AF320845)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum putative NBS-LRR disease resistance protein RCCN4 (Rccn4) gene, partial cds.

DNA Sequence

TGATACTGGATGATGTCTGGTGCAATGCGGATGTTGGTAACCAGGAGCTACCAAAGTTACTTTCTCCACTTAAGAAAGGAAAGAAAGAAAGCAAGATCCCAGTGACAACTCGAAGTAAATATGCACTACCGGATCTATGTCCTGGTGTGAGATATACTGCCATGCCGATAACTGAGGTTGATGATACCGCCTTCTTTGAGTTGTTCATGCATTATGCCCTCGAAGATGGCCAAGATCAAAGCATGTTCCAGAACATTGGGGTTGAGATTGCAAAAAAGCTGAAGGGGTCACCTTTAGCAGCTAGAACAGTGGGTGGAAATTTACGTCGACAGCAAGATGTTGACCATTGGAGAAGAGTCGGAGATCAAGACCTTTTCAAGGTATGGACGGGACCTCTGTGGTGGAGCTACTATCAGCTTGGTGAGCAGGCTAGGCGTTGCTTTGCTTACTGCAGTATTTTTCCTAGGAGACATCGCTTGTACCGTGATGAATTAGTTAGACTCTGGATGGCAGAAGGGTTCATAAGAAGCAC


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein RCCN4 putative NBS-LRR disease resistance protein RCCN4 [Triticum aestivum].

ILDDVWCNADVGNQELPKLLSPLKKGKKESKIPVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWTGPLWWSYYQLGEQARRCFAYCSIFPRRHRLYRDELVRLWMAEGFIRST


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-129 SSF52540

ILDDVWCNADVGNQELPKLLSPLKKGKKESKIPVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWT

HMMPfam: PF00931
IPR002182
1-175 NB-ARC,NBS
NB-ARC

ILDDVWCNADVGNQELPKLLSPLKKGKKESKIPVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWTGPLWWSYYQLGEQARRCFAYCSIFPRRHRLYRDELVRLWMAEGFIR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox