PRGDB00049218 (disease resistance protein RPP1-WsC)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-WsC
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3860166 (AF098964)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-WsC gene, partial cds.

DNA Sequence

ATGGGTTCTGCAATGAGCTTGAGCTGTTCCAAGAGGAAAGCAACGAGTCAGGATGTTGATTCCGAATCTTGTAAAAGACGAAAGATATGCTCAACAAACGATGCTGAGAATTGCATATTCATTCCGGATGAGTCATCTTGGAGTTTATGTGCCAACAGAGTCATCAGTGATAACCAAGAAAGTAATTCTTCTTCTTTATCTCTTCCCTCCCCTGCAACTTCTGTGTCTCGAAACTGGAAACACGATGTCTTCCCGAGCTTCCACGGAGCAGATGTCCGAAGAACCTTTCTTAGTCACATCATGGAATCGTTCAGAAGAAAGGGAATTGACACATTCATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCCTGAGCTCAAAAAAGCTATCAAAGGATCAAAGATCGCAATCGTTTTGCTCTCAAGGAAATATGCTTCTTCGTCATGGTGTCTTGATGAGTTGGCCGAGATCATGAAATGCAGGGAAGTGTTGGGTCAGATTGTCATGACCATTTTCTATGAAGTGGAGCCAACTGACATAAAGAAACAGACTGGTGAATTCGGAAAAGCCTTCACAAAAACATGTAGAGGTAAAACAAAAGAGCATATTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAAATGGAGGAATGAAGCAGACATGATTGAGAAAATAGCCACTGATGTTTCAAACATGTTAAATAGTTGCACACCATCAAGAGATTTCGACGGGTTAGTAGGGATGAGAGCTCATATGAATATGATGGAACATTTGTTGCGCTTAGATTTGGATGAAGTAAGGATAATCGGGATTTGGGGACCGCCTGGGATTGGTAAGACAACTATCGCCAGATTTCTGCTTAACCAAGTCTCCGACAGATTCCAACTTAGTGCAATCATGGTCAATATCAAAGGATGCTATCCAAGACCTTGTTTCGATGAGTACAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTTGTTCTCGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCCCATGGGATCAATCATGTTTACAAAGTGGGATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCACATGAAGGTTTCGATGAGATTGCTAGGGAAGTTATGGCTTTAGCTGGTGAACTCCCTTTGGGATTGACGGTTCTAGGCTCTGCTTTGCGGGGGAAGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAAAACTAGCCTCGATGGAAATATCGGGAGCATTATACAGTTCAGTTACGATGCCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGTCTTTTTAACGACGAATCAACAACCAAAGTGAAAGAGCTTCTTGGAAAGTTCTTGGATGTGAAACAAGGTCTTCACGTATTAGCTCAGAAATCTCTCATATCCCTGTCTTATTTGACGTTTTATGGAGAAAGAATACATATGCATACTCTGCTAGAACAATTCGGAAGAGAAACTTCTCGTAAGCAATTCGTTCATCATGGCTTTACGAAACGTCAGCTTTTGGTTGGTGCAAGGGGTATATGTGAAGTGCTCGACGATGATACAACAGATAGTAGACGTTTTATAGGGATAAATTTGGAGTTGTCTAATACTGAGGAAGAATTGAATATAAGTGAGAAAGTACTTGAAAGAGTGCATGATTTTCATTTCGTGAGAATCGATGCTAGTTTTCAACCTGAGAGACTGCAACCTGAGAGACTGCAGTTAGCACTACAAGATCTGATTTATCATTCTCCAAAGATTAGATCACTGAAGTGGCATCGTTACCAGAATATATGTTTGCCTTCTACTTTTAATCCGGAGTTTCTCATCGAACTAGATATGCGTTACAGCAAGCTTCAGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGAGTTTGAGTTATTCTATAGATCTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTAAAGCTTAGTAATTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTCACCAGTCTCCAGATATTAGATCTCCAAAGTTGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGGAATGCAACTAAACTTGAGATACTTGATCTTGATTATTGTTCGAGTCTTGTGAAGCTCCCACCATCTATCAATGCCAATAACCTCCAGGAATTGTCTCTAAGAAATTGTTCACGTCTAATAGAGCTCCCTCTTTCTATTGGAACTGCCACAAATCTGAAGAAATTGAATATGAAAGGATGCTCAAGTCTCGTGAAACTCCCATCCTCTATTGGAGATATCACTGACCTCGAAGTGTTAGATCTATCTAACTGCTCAAATCTGGTGGAGCTACCTTCCTCTATAGGAAACCTTCAAAAATTGATTGTGTTGACAATGCACGGATGCTCAAAGCTAGAGACTCTTCCAATCAACATCAACTTGAAAGCTCTCAGTACACTTTATCTCACAGATTGCTCGCGGTTGAAACGTTTTCCTGAGATCTCCACAAACATTAAGTATCTCTGGCTCACAGGAACTGCGATAAAAGAAGTTCCTTTGTCGATCATGTCGTGGTCTCGTCTTGCTGAATTTCGGATATCATATTTTGAAAGCCTCAAGGAATTCCCGCATGCTTTTGACATCATCACGAAGCTGCAGTTGAGCAAAGATATACAAGAAGTTCCTCCATGGGTCAAGAGAATGTCTCGTTTACGTGTTCTTAGTCTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTTCAGATTCCCTTGATTACATACATGCAGATAATTGTAAGTCCCTCGAGAAACTAGATTGTTGCTTTAACAATCCAGATATTCGTCTCAATTTCCCCAACTGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACATCACCTTGTATAGATGCGATGTTACCCGGTACACAAGTGCCTGCCTGCTTCAATCACCGAGCTACTTCTGGGGATTACTTGAAAATCAAGTTGAAGGAGTCGCCTTTTCCTACAACCTTGAGATTTAAGGCTTGTATCATGCTTGTTAAGGTTAATGAAGAAATGAGAGATGATAGGAGATGGATGGATGATAGGATGCTTTATATATTACAAAAGTTGAACAGAATGCTTGTTAAGGTTGACATTGACATCAGGGATGAACATAATGATCTCAAAGTTCAGTGTACACCAAACGATTATATTATATATCCACTTTTAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACATTAGACAACGAAAGATATTGGAAGATAGGAGAATGCGGGATAGTCCAAAGAGAAACGAGATTACTTCGCAGGAGCTCTTCGCCGGATCTCTCGCCGGAATCTTCTCGTGTTTCTTA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-WsC disease resistance protein RPP1-WsC [Arabidopsis thaliana].

MGSAMSLSCSKRKATSQDVDSESCKRRKICSTNDAENCIFIPDESSWSLCANRVISDNQESNSSSLSLPSPATSVSRNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSCTPSRDFDGLVGMRAHMNMMEHLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLTVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDVKQGLHVLAQKSLISLSYLTFYGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLDDDTTDSRRFIGINLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQPERLQLALQDLIYHSPKIRSLKWHRYQNICLPSTFNPEFLIELDMRYSKLQKLWEGTKQLRNLKWMSLSYSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSLVELPSFGNATKLEILDLDYCSSLVKLPPSINANNLQELSLRNCSRLIELPLSIGTATNLKKLNMKGCSSLVKLPSSIGDITDLEVLDLSNCSNLVELPSSIGNLQKLIVLTMHGCSKLETLPININLKALSTLYLTDCSRLKRFPEISTNIKYLWLTGTAIKEVPLSIMSWSRLAEFRISYFESLKEFPHAFDIITKLQLSKDIQEVPPWVKRMSRLRVLSLNNCNNLVSLPQLSDSLDYIHADNCKSLEKLDCCFNNPDIRLNFPNCFKLNQEARDLIMHTSPCIDAMLPGTQVPACFNHRATSGDYLKIKLKESPFPTTLRFKACIMLVKVNEEMRDDRRWMDDRMLYILQKLNRMLVKVDIDIRDEHNDLKVQCTPNDYIIYPLLTEHIYTFELEVEEVTSTELVFEFTLDNERYWKIGECGIVQRETRLLRRSSSPDLSPESSRVS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
77-215 G3DSA:3.40.50.10140

RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVA

ProfileScan: PS50104
IPR000157
79-217 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATI

HMMSmart: SM00255
IPR000157
80-217 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATI

HMMPfam: PF01582
IPR000157
83-212 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALE

HMMPanther: PTHR23155
91-1061 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSCTPSRDFDGLVGMRAHMNMMEHLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLTVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDVKQGLHVLAQKSLISLSYLTFYGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLDDDTTDSRRFIGINLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQPERLQLALQDLIYHSPKIRSLKWHRYQNICLPSTFNPEFLIELDMRYSKLQKLWEGTKQLRNLKWMSLSYSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSLVELPSFGNATKLEILDLDYCSSLVKLPPSINANNLQELSLRNCSRLIELPLSIGTATNLKKLNMKGCSSLVKLPSSIGDITDLEVLDLSNCSNLVELPSSIGNLQKLIVLTMHGCSKLETLPININLKALSTLYLTDCSRLKRFPEISTNIKYLWLTGTAIKEVPLSIMSWSRLAEFRISYFESLKEFPHAFDIITKLQLSKDIQEVPPWVKRMSRLRVLSLNNCNNLVSLPQLSDSLDYIHADNCKSLEKLDCCFNNPDIRLNFPNCFKLNQEARDLIMHTSPCIDAMLPGTQ

HMMPanther: PTHR23155:SF296
91-1061 PTHR23155:SF296

DVRRTFLSHIMESFRRKGIDTFIDNNIERSKSIGPELKKAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSCTPSRDFDGLVGMRAHMNMMEHLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLTVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDVKQGLHVLAQKSLISLSYLTFYGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLDDDTTDSRRFIGINLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQPERLQLALQDLIYHSPKIRSLKWHRYQNICLPSTFNPEFLIELDMRYSKLQKLWEGTKQLRNLKWMSLSYSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSLVELPSFGNATKLEILDLDYCSSLVKLPPSINANNLQELSLRNCSRLIELPLSIGTATNLKKLNMKGCSSLVKLPSSIGDITDLEVLDLSNCSNLVELPSSIGNLQKLIVLTMHGCSKLETLPININLKALSTLYLTDCSRLKRFPEISTNIKYLWLTGTAIKEVPLSIMSWSRLAEFRISYFESLKEFPHAFDIITKLQLSKDIQEVPPWVKRMSRLRVLSLNNCNNLVSLPQLSDSLDYIHADNCKSLEKLDCCFNNPDIRLNFPNCFKLNQEARDLIMHTSPCIDAMLPGTQ

superfamily: SSF52540
134-506 SSF52540

SKIAIVLLSRKYASSSWCLDELAEIMKCREVLGQIVMTIFYEVEPTDIKKQTGEFGKAFTKTCRGKTKEHIERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSCTPSRDFDGLVGMRAHMNMMEHLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLTVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
244-402 G3DSA:3.40.50.300

NSCTPSRDFDGLVGMRAHMNMMEHLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLK

HMMPfam: PF00931
IPR002182
263-519 NB-ARC,NBS
NB-ARC

NMMEHLLRLDLDEVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLTVLGSALRGKSKPEWERTLPRLKTSLDGNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTK

HMMSmart: SM00382
IPR003593
275-415 AAA,NBS
AAA+ ATPase domain

EVRIIGIWGPPGIGKTTIARFLLNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYP

FPrintScan: PR00364
IPR000767
278-293 DISEASERSIST
Disease resistance protein

IIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
449-463 DISEASERSIST
Disease resistance protein

AGELPLGLTVLGSAL

superfamily: SSF46785
484-595 SSF46785

GNIGSIIQFSYDALCDEDKYLFLYIACLFNDESTTKVKELLGKFLDVKQGLHVLAQKSLISLSYLTFYGERIHMHTLLEQFGRETSRKQFVHHGFTKRQLLVGARGICEVLD

superfamily: SSF52058
653-914 SSF52058,LRR

ALQDLIYHSPKIRSLKWHRYQNICLPSTFNPEFLIELDMRYSKLQKLWEGTKQLRNLKWMSLSYSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSLVELPSFGNATKLEILDLDYCSSLVKLPPSINANNLQELSLRNCSRLIELPLSIGTATNLKKLNMKGCSSLVKLPSSIGDITDLEVLDLSNCSNLVELPSSIGNLQKLIVLTMHGCSKLETLPININLKALSTLYLTDCSRLKRFPEI

Gene3D: G3DSA:3.80.10.10
653-829 G3DSA:3.80.10.10

ALQDLIYHSPKIRSLKWHRYQNICLPSTFNPEFLIELDMRYSKLQKLWEGTKQLRNLKWMSLSYSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSLVELPSFGNATKLEILDLDYCSSLVKLPPSINANNLQELSLRNCSRLIELPLSIGTATNLKKL

HMMPfam: PF07725
IPR011713
685-704 LRR_3
Leucine-rich repeat 3

FLIELDMRYSKLQKLWEGTK

HMMPfam: PF00560
IPR001611
731-753 LRR_1
Leucine-rich repeat

NLEELKLSNCSSLVELPSSIEKL

HMMPfam: PF00560
IPR001611
755-775 LRR_1
Leucine-rich repeat

SLQILDLQSCSSLVELPSFGN

HMMPfam: PF13504
801-817 LRR_7,Leucine rich repeat

NLQELSLRNCSRLIELP

Gene3D: G3DSA:3.80.10.10
830-1024 G3DSA:3.80.10.10

NMKGCSSLVKLPSSIGDITDLEVLDLSNCSNLVELPSSIGNLQKLIVLTMHGCSKLETLPININLKALSTLYLTDCSRLKRFPEISTNIKYLWLTGTAIKEVPLSIMSWSRLAEFRISYFESLKEFPHAFDIITKLQLSKDIQEVPPWVKRMSRLRVLSLNNCNNLVSLPQLSDSLDYIHADNCKSLEKLDCCFN

FPrintScan: PR00364
IPR000767
845-861 DISEASERSIST
Disease resistance protein

GDITDLEVLDLSNCSNL

HMMPfam: PF00560
IPR001611
850-871 LRR_1
Leucine-rich repeat

LEVLDLSNCSNLVELPSSIGNL

superfamily: SSF52058
916-1038 SSF52058,LRR

TNIKYLWLTGTAIKEVPLSIMSWSRLAEFRISYFESLKEFPHAFDIITKLQLSKDIQEVPPWVKRMSRLRVLSLNNCNNLVSLPQLSDSLDYIHADNCKSLEKLDCCFNNPDIRLNFPNCFKL

HMMPfam: PF13504
982-999 LRR_7,Leucine rich repeat

SRLRVLSLNNCNNLVSLP


List of References

M A Botella, J E Parker, L N Frost, P D Bittner-Eddy, J L Beynon, M J Daniels, E B Holub, J D Jones
Three genes of the Arabidopsis RPP1 complex resistance locus recognize distinct Peronospora parasitica avirulence determinants.
Plant Cell: 1998, 10(11);1847-60
PubMed:9811793 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox