PRGDB00049219 (disease resistance protein RPP1-WsB)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPP1-WsB
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3860164 (AF098963)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein RPP1-WsB gene, partial cds.

DNA Sequence

ATGGGTTCTGCAATGAGCTTGGGCTGTTCCAAGAGGAAAGCAACAAATCAGGATGTTGATTCCGAATCTCGTAAAAGACGAAAGATATGCTCAACAAACGATGCTGAGAATTGCAGATTCATTCAGGATGAGTCATCTTGGAAACATCCATGGAGTTTATGTGCCAACAGTGTCGTCAACGACACCAAAGATACTAAATCTTCTGCTTTATCTCTTCCATCTCCTCCAACTTCAGTGTCTCGAATCTGGAAACACCAAGTCTTCCCGAGCTTCCATGGGGCAGATGTTCGAAAAACCATTCTTAGTCACATCCTCGAATCGTTCAGAAGAAAGGGAATTGACCCATTTATTGATAATAATATAGAGAGGAGTAAGTCGATCGGTCATGAGCTCAAAGAAGCTATCAAAGGATCAAAGATCGCGATCGTCTTGCTCTCAAAGAACTATGCTTCTTCATCTTGGTGCCTTGATGAATTAGCAGAAATCATGAAGTGTAGGGAATTGTTGGGTCAGATAGTCATGACTATTTTCTATGAAGTGGATCCAACTGACATAAAGAAACAGACCGGTGAATTTGGAAAAGCCTTCACAAAAACATGTAAAGGTAAAACAAAAGAGTATGTTGAGAGATGGAGAAAAGCTTTGGAGGATGTGGCAACAATCGCCGGATATCATTCTCACAAATGGAGGAATGAAGCAGACATGATTGAGAAAATAGCCACTGATGTTTCAAACATGTTAAATAGTTTCAAACCATCAAGAGATTTCAACGGGTTAGTAGGGATGAGAGCTCATATGGATATGCTGGAACAATTGTTGCGCCTAGTTTTGGATGAAGTAAGGATGATCGGGATTTGGGGACCGCCTGGGATTGGTAAGACAACTATCGCCAGATTTCTGTTTAATCAAGTCTCCGACAGATTCCAACTTAGTGCAATCATGGTCAATATCAAAGGATGCTATCCAAGACCTTGTTTCGATGAGTACAGTGCACAATTGCAACTACAAAACCAAATGTTGTCCCAGATGATCAATCATAAAGATATCATGATTTCTCATTTAGGAGTGGCTCAAGAACGGTTGAGAGACAAGAAAGTGTTTCTTGTTCTCGATGAAGTGGATCAATTAGGACAACTAGATGCCTTGGCGAAAGAAACTCGATGGTTTGGTCCTGGAAGTCGGATTATTATCACAACAGAAGATCTAGGAGTTTTGAAGGCTCATGGGATCAATCATGTTTACAAAGTGGGATATCCATCAAATGACGAGGCTTTTCAAATCTTCTGTATGAATGCCTTTGGTCAGAAACAACCACATGAAGGTTTCGATGAGATTGCTAGGGAAGTTATGGCTTTAGCTGGTGAACTCCCTTTGGGATTGAAGGTTCTAGGCTCTGCTTTGCGGGGGAAGTCCAAGCCAGAGTGGGAAAGAACACTACCAAGGTTAAAAACTAGCCTCGACGGAAAAATCGGGAGCATTATACAGTTCAGTTACGATGCCTTATGTGACGAAGATAAATATCTATTTCTTTATATAGCCTGCCTTTTTAACAAGGAATCAACAACCAAAGTGGAAGGGCTTCTTGGAAAGTTCTTGGATGTGAGACAAGGTCTTCACATATTAGCTCAGAAATCTCTCATATCTATTGAAGACGGAAATATATACATGCATACTCTGCTAGAACAGTTCGGAAGAGAAACTTCCCGTAAGCAATTCATTCATCATGGCTATACGAAACATCAGCTTTTGGTTGGTGAAAGGGATATATGTGAAGTACTCAATGACGATACAATAGATAGTAGGCGTTTTATAGGGATAAATTTGGATTTATATAAGAATGTGGAAGAATTAAATATAAGTGAGAAAGCACTTGAAAGAATCCATGATTTTCAATTCGTTAGAATCAATGGTAAGAATCATGCTCTACATGAGAGACTGCAAGGTCTGATTTATCAATCTCCACAGATTAGATCACTGCATTGGAAGTGTTACCAGAATATATGTTTGCCTTCTACTTTTAATTCGGAGTTTCTCGTCGAACTAGATATGAGTTTCAGCAAGCTTCAGAAGCTATGGGAAGGAACTAAACAACTTAGAAATCTCAAGTGGATGGATTTGAGTTATTCTAGTTATCTGAAAGAGCTTCCCAATCTTTCAACTGCAACTAATCTCGAAGAATTAAAGCTTAGAAATTGCTCAAGTTTAGTGGAGCTCCCCTCCTCTATTGAAAAACTCACCAGTCTCCAGATATTAGATCTCCACAGATGCTCAAGTCTTGTGGAGCTTCCCTCTTTTGGAAACGCAACTAAACTTGAGATACTAAATCTTGAAAATTGTTCGAGTCTTGTGAAGCTCCCACCATCTATCAATGCCAATAATCTCCAGGAATTGTCTCTAACAAATTGTTCACGTGTTGTGGAGCTCCCCGCTATCGAGAATGCGACTAATCTCTGGAAATTGAATCTGCTTAATTGCTCAAGTCTAATAGAGCTCCCTCTTTCTATTGGAACTGCCACAAATCTGAAGCATTTGGATTTTCGCGGATGCTCAAGTCTCGTGAAACTCCCATCCTCTATTGGAGATATGACAAATCTCGAAGTGTTTTATCTATCTAACTGCTCAAATCTGGTGGAGCTTCCTTCCTCTATTGGAAACCTTCGAAAATTGACTCTGTTGTTAATGAGAGGATGCTCAAAGCTAGAGACTCTTCCAACCAACATCAACTTGAAATCTCTCCATACACTTAATCTCATAGATTGCTCGCGGTTGAAAAGTTTTCCTGAGATCTCCACACACATTAAGTATCTCAGGCTCATAGGAACTGCAATAAAAGAAGTTCCTTTGTCGATCATGTCGTGGTCTCCTCTTGCTCACTTTCAGATTTCATACTTTGAAAGCCTCAAGGAATTCCCGCATGCTCTTGACATCATCACGGAGTTGCAGTTGAGCAAAGATATACAAGAAGTTCCTCCATGGGTCAAGAGAATGTCTCGTTTACGTGCTCTTAGACTCAACAACTGCAATAATCTGGTATCACTCCCCCAACTTCCAGATTCCCTTGCTTACTTATATGCAGATAATTGTAAGTCCCTTGAGAGATTGGATTGTTGCTTTAACAATCCAGAGATCCGTCTCTATTTCCCCAAATGCTTCAAACTGAATCAAGAAGCCAGAGATCTCATCATGCACACATCAACTCGTAATTTTGCCATGTTACCCGGTACACAAGTGCCTGCCTGCTTCAATCACCGAGCTACTTCTGGGGATTCCTTGAAAATCAAGTTGAAGGAGTCGCCTCTTCCTACAACCTTGACATTTAAGGCTTGTATCATGCTTGTTAATGAAGAAATGAGTTATGATCTGAAATCGATGAGCGTTGACATTGTCATCAGGGACGAACAGAATGATCTCAAAGTTCAGTGTACACCAAGCTATCATCAGTGTACAGAGATATATGTTTTAACAGAGCATATATACACATTTGAACTTGAAGTAGAGGAGGTGACTTCCACGGAGCTTGTCTTTGAGTTCACATCAGTCAACGAAAGCATTTGCAAGATAGGAGAATGCGGGATACTCCAAAGAGAAACGAGATCACTTCGCCGGAGCTCTTCGCCGGATCTCTCGCCGGAATCTTCTCGTGTTTCTAGCTGCGACCACTGTTA


Protein sequences

Name Description Sequence
disease resistance protein RPP1-WsB disease resistance protein RPP1-WsB [Arabidopsis thaliana].

MGSAMSLGCSKRKATNQDVDSESRKRRKICSTNDAENCRFIQDESSWKHPWSLCANSVVNDTKDTKSSALSLPSPPTSVSRIWKHQVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSFKPSRDFNGLVGMRAHMDMLEQLLRLVLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGKIGSIIQFSYDALCDEDKYLFLYIACLFNKESTTKVEGLLGKFLDVRQGLHILAQKSLISIEDGNIYMHTLLEQFGRETSRKQFIHHGYTKHQLLVGERDICEVLNDDTIDSRRFIGINLDLYKNVEELNISEKALERIHDFQFVRINGKNHALHERLQGLIYQSPQIRSLHWKCYQNICLPSTFNSEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSRVVELPAIENATNLWKLNLLNCSSLIELPLSIGTATNLKHLDFRGCSSLVKLPSSIGDMTNLEVFYLSNCSNLVELPSSIGNLRKLTLLLMRGCSKLETLPTNINLKSLHTLNLIDCSRLKSFPEISTHIKYLRLIGTAIKEVPLSIMSWSPLAHFQISYFESLKEFPHALDIITELQLSKDIQEVPPWVKRMSRLRALRLNNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRNFAMLPGTQVPACFNHRATSGDSLKIKLKESPLPTTLTFKACIMLVNEEMSYDLKSMSVDIVIRDEQNDLKVQCTPSYHQCTEIYVLTEHIYTFELEVEEVTSTELVFEFTSVNESICKIGECGILQRETRSLRRSSSPDLSPESSRVSSCDHC

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
83-219 G3DSA:3.40.50.10140

WKHQVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVA

ProfileScan: PS50104
IPR000157
83-221 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WKHQVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATI

HMMSmart: SM00255
IPR000157
84-221 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KHQVFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATI

HMMPfam: PF01582
IPR000157
87-216 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFHGADVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALE

HMMPanther: PTHR23155:SF296
95-1076 PTHR23155:SF296

DVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSFKPSRDFNGLVGMRAHMDMLEQLLRLVLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGKIGSIIQFSYDALCDEDKYLFLYIACLFNKESTTKVEGLLGKFLDVRQGLHILAQKSLISIEDGNIYMHTLLEQFGRETSRKQFIHHGYTKHQLLVGERDICEVLNDDTIDSRRFIGINLDLYKNVEELNISEKALERIHDFQFVRINGKNHALHERLQGLIYQSPQIRSLHWKCYQNICLPSTFNSEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSRVVELPAIENATNLWKLNLLNCSSLIELPLSIGTATNLKHLDFRGCSSLVKLPSSIGDMTNLEVFYLSNCSNLVELPSSIGNLRKLTLLLMRGCSKLETLPTNINLKSLHTLNLIDCSRLKSFPEISTHIKYLRLIGTAIKEVPLSIMSWSPLAHFQISYFESLKEFPHALDIITELQLSKDIQEVPPWVKRMSRLRALRLNNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRNFAMLPGTQ

HMMPanther: PTHR23155
95-1076 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DVRKTILSHILESFRRKGIDPFIDNNIERSKSIGHELKEAIKGSKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSFKPSRDFNGLVGMRAHMDMLEQLLRLVLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGKIGSIIQFSYDALCDEDKYLFLYIACLFNKESTTKVEGLLGKFLDVRQGLHILAQKSLISIEDGNIYMHTLLEQFGRETSRKQFIHHGYTKHQLLVGERDICEVLNDDTIDSRRFIGINLDLYKNVEELNISEKALERIHDFQFVRINGKNHALHERLQGLIYQSPQIRSLHWKCYQNICLPSTFNSEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSRVVELPAIENATNLWKLNLLNCSSLIELPLSIGTATNLKHLDFRGCSSLVKLPSSIGDMTNLEVFYLSNCSNLVELPSSIGNLRKLTLLLMRGCSKLETLPTNINLKSLHTLNLIDCSRLKSFPEISTHIKYLRLIGTAIKEVPLSIMSWSPLAHFQISYFESLKEFPHALDIITELQLSKDIQEVPPWVKRMSRLRALRLNNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRNFAMLPGTQ

superfamily: SSF52540
138-510 SSF52540

SKIAIVLLSKNYASSSWCLDELAEIMKCRELLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTCKGKTKEYVERWRKALEDVATIAGYHSHKWRNEADMIEKIATDVSNMLNSFKPSRDFNGLVGMRAHMDMLEQLLRLVLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGKIGSIIQFSYDALCDEDKYLFL

Gene3D: G3DSA:3.40.50.300
246-406 G3DSA:3.40.50.300

MLNSFKPSRDFNGLVGMRAHMDMLEQLLRLVLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLK

HMMPfam: PF00931
IPR002182
267-521 NB-ARC,NBS
NB-ARC

DMLEQLLRLVLDEVRMIGIWGPPGIGKTTIARFLFNQVSDRFQLSAIMVNIKGCYPRPCFDEYSAQLQLQNQMLSQMINHKDIMISHLGVAQERLRDKKVFLVLDEVDQLGQLDALAKETRWFGPGSRIIITTEDLGVLKAHGINHVYKVGYPSNDEAFQIFCMNAFGQKQPHEGFDEIAREVMALAGELPLGLKVLGSALRGKSKPEWERTLPRLKTSLDGKIGSIIQFSYDALCDEDKYLFLYIACLFNKEST

FPrintScan: PR00364
IPR000767
282-297 DISEASERSIST
Disease resistance protein

MIGIWGPPGIGKTTIA

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

RLRDKKVFLVLDEVD

FPrintScan: PR00364
IPR000767
453-467 DISEASERSIST
Disease resistance protein

AGELPLGLKVLGSAL

superfamily: SSF46785
488-594 SSF46785

GKIGSIIQFSYDALCDEDKYLFLYIACLFNKESTTKVEGLLGKFLDVRQGLHILAQKSLISIEDGNIYMHTLLEQFGRETSRKQFIHHGYTKHQLLVGERDICEVLN

Gene3D: G3DSA:3.80.10.10
612-825 G3DSA:3.80.10.10

KNVEELNISEKALERIHDFQFVRINGKNHALHERLQGLIYQSPQIRSLHWKCYQNICLPSTFNSEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSRVVELPAIENATNLWKLNLLNC

superfamily: SSF52058
619-905 SSF52058,LRR

ISEKALERIHDFQFVRINGKNHALHERLQGLIYQSPQIRSLHWKCYQNICLPSTFNSEFLVELDMSFSKLQKLWEGTKQLRNLKWMDLSYSSYLKELPNLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSRVVELPAIENATNLWKLNLLNCSSLIELPLSIGTATNLKHLDFRGCSSLVKLPSSIGDMTNLEVFYLSNCSNLVELPSSIGNLRKLTLLLMRGCSKLETLPT

HMMPfam: PF07725
IPR011713
677-696 LRR_3
Leucine-rich repeat 3

FLVELDMSFSKLQKLWEGTK

HMMPfam: PF00560
IPR001611
723-745 LRR_1
Leucine-rich repeat

NLEELKLRNCSSLVELPSSIEKL

FPrintScan: PR00364
IPR000767
743-759 DISEASERSIST
Disease resistance protein

EKLTSLQILDLHRCSSL

HMMPfam: PF00560
IPR001611
747-767 LRR_1
Leucine-rich repeat

SLQILDLHRCSSLVELPSFGN

HMMPfam: PF00560
IPR001611
770-789 LRR_1
Leucine-rich repeat

KLEILNLENCSSLVKLPPSI

Gene3D: G3DSA:3.80.10.10
838-1039 G3DSA:3.80.10.10

ATNLKHLDFRGCSSLVKLPSSIGDMTNLEVFYLSNCSNLVELPSSIGNLRKLTLLLMRGCSKLETLPTNINLKSLHTLNLIDCSRLKSFPEISTHIKYLRLIGTAIKEVPLSIMSWSPLAHFQISYFESLKEFPHALDIITELQLSKDIQEVPPWVKRMSRLRALRLNNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFN

superfamily: SSF52058
839-1053 SSF52058,LRR

TNLKHLDFRGCSSLVKLPSSIGDMTNLEVFYLSNCSNLVELPSSIGNLRKLTLLLMRGCSKLETLPTNINLKSLHTLNLIDCSRLKSFPEISTHIKYLRLIGTAIKEVPLSIMSWSPLAHFQISYFESLKEFPHALDIITELQLSKDIQEVPPWVKRMSRLRALRLNNCNNLVSLPQLPDSLAYLYADNCKSLERLDCCFNNPEIRLYFPKCFKL

HMMPfam: PF00560
IPR001611
840-860 LRR_1
Leucine-rich repeat

NLKHLDFRGCSSLVKLPSSIG

HMMPfam: PF00560
IPR001611
864-886 LRR_1
Leucine-rich repeat

NLEVFYLSNCSNLVELPSSIGNL

HMMPfam: PF13504
997-1014 LRR_7,Leucine rich repeat

SRLRALRLNNCNNLVSLP


List of References

M A Botella, J E Parker, L N Frost, P D Bittner-Eddy, J L Beynon, M J Daniels, E B Holub, J D Jones
Three genes of the Arabidopsis RPP1 complex resistance locus recognize distinct Peronospora parasitica avirulence determinants.
Plant Cell: 1998, 10(11);1847-60
PubMed:9811793 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox