PRGDB00049221 (RPM1)

From PRG Wiki
Jump to: navigation, search
RPM1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5231013 (AF122982)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis lyrata

Comment?

Arabidopsis lyrata cultivar 24 NBS/LRR disease resistance protein RPM1 (RPM1) gene, RPM1-lyr allele, complete cds. and 3' sequence.

DNA Sequence

ATGGCTTCGGCTACTGTTGATTTTGGGATCGGACGGATTCTTAGTGTCCTGGAAAACGAGACCTTGTTATTATCAGGAGTCCATGTTGAGATTGATAAAATGAAGAAGGAGTTGCTGATCATGAAGTCTTTTCTTGAGGACACCCATCAACATGGTGGAAATGGATCCATAGCAACAACAACTCAAGTCTTCCAAACTTTTGTGGCAAACACGAGAGATCGAAGACATTCTCGACGAGTTTGGCTATCACATCCACGTTATCGTAGTTGCGCCAAACTTTGGCGTGCGTTTCATTTCCCGAGGTATATGTGGGCGAGGCACTCAATAGCTCAGAAGCTAGGAGTGGTGAATGTCATGATTCAATCCATTTCTGATTCCATGAAAAGGTACTATCATTCAGAAAACTATCAAGCAGCAATATTATCGCCTACTGATGATGGCGATGCAAAGTGGGTGAACAACATCAGTGAGTCATCTCTTTTCTTTAGTGAAAATAGTCTTGTAGGGATTGATGCACCCAAGGGAAAGCTCATCGGACGGCTTCTAAGTCCGGAACCTCAGCGGATTGTTGTCGCCGTGGTTGGGATGGGCGGTTCAGGGAAGACTACACTCTCAGCGAATATCTTCAAGTCCCAGAGCGTGCGGAGGCATTTTGAGTGTTACGCTTGGGTTACAATCTCGAAATCTTATGAGATTGAAGATGTATTTAGGACCATGATCAAGGAGTTCTATAAAGAAGCTGAAACACAGATTCCAGCTGAATTATACTCCTTAGGCTACAGAGAGTTGGTGGAAAAACTTGTGGAGTATTTGCAGTCAAAGAGGTACATTGTTGTGCTTGATGATGTATGGACCACTGGTCTATGGAGGGAGATAAGTATCGCTCTACCAGATGGTATTTACGGAAGTCGTGTTATGATGACCACTCGGGACATGAACGTGGCTTCTTTCCCATATGGAATCGGGAGCACAAAGCACGAGATTGAGCTCTTAAAAGAAGACGAAGCTTGGGTGCTTTTCTCCAACAAAGCTTTTCCGGGAAGTCTTGAGCAATGCAGAACGCAGAATTTAGAGCCGATAGCACGGAAATTACTCGAGAGATGTCAGGGTTTGCCATTAGCTATTGCTTCTTTGGGGAGCATGATGTCAACCAAGAAGTTTGAATCAGAATGGAAGAAAGTCTACAGTACTTTGAATTGGGAATTGAACAACAATCTTGAACTCAAGATTGTTCGAAGCATTTTGTTGCTTAGCTTCAACGATTTGCCATACCCGCTTAAACGTTGTTTCTTATATTGTTCTCTTTTCCCTGTGAACTATCGGATGAAAAGAAAGAGGCTCGTTAGGATGTGGATGGCACAAAGATTTGTGGAACCGATCAGAGGAGTGAAAGCAGAAGAAGTGGCTGATAGTTACCTCAATGAACTTGTTTACAGAAATATGCTTCAAGTTATCTTGTGGAATCCTTTTGGACGACCCAAGGCGTTCAAGATGCATGACGTGATATGGGAGATTGCTCTATCTGTATCCAAACTTGAGAGGTTTTGTGATGTATATAATGATGACAGCGATGGTGATGATGCTGCAGAGACAATCGAGAATTATGGTAGTCGCCATTTATGCATTCAGAAAGAGATGACACCAGATAGTATACGTGCAACAAACCTTCACTCTCTTTTGGTTTGCTCTTCTGCTAAACACAAGATGGACTTACTTCCAAGTCTGAAACTTCTGAGAGCCTTAGACCTTGAAGATTCTGCCATCAGCAAGTTACCAGATTGTTTAGTAACTATGTTCAACCTAAAGTACTTGAATTTGTCGAAGACACAGGTAAAAGAACTGCCAAAAGACTTCCATAAACTCATCAATTTGGAGACATTGAATACAAAGCACTCCAAGATTGAGGAACTTCCTCCAGGGATGTGGAAGTTGCAGAAGTTGCGTTATCTCATTACTTTTCGGCGCAATGATGGACATGATTCCAATTGGAACTATGTTTTAGGTACAAGGGTTGTTCCTAAAATCTGGCAGTTGAAGGATTTGCAAGTCATGGACTGCTTCAACGCAGAAGCTGAGCTTATCAAAAACCTTGGGAATATGACTCAACTCACAAGAATAAGTCTTGTCATGGTTAGGAGAGAACATGGAAGAGACTTATGTGATTCACTGAATAAGATTAGAAGACTTCGGTTCTTATCTTTAACGTCGATTCATGAAGAGGAACCGTTAGAGATAGATGACCTGATAGCAACTGCAAGCATTGAGAAGCTCTTTCTTGCTGGGAAACTGGAGAGGGTACCAATTTGGTTCAACACCCTTCAAAACCTTACCTATTTGGGTTTGCGTGGATCTCAGTTGCAAGAAAACGCCATTCTCTCTATCCAAACGCTTCCTAGATTGGTATGGCTTTCGTTTTACAATGCATACATGGGGCCTAGGTTGTGTTTTGCACAAGGATTTCAGAATCTGAAGATTCTAGAGATAGTTCAGATGAAACATCTGACAGAAGTTGTTATAGAAGATGGTGCAATGTTTGAGCTTCAGAAGCTTTATATCAGGGCTTGTAGAGGGTTAGAGTCGGTACCGAAAGGAATTGAGAATCTTATAAATCTTCAAGAACTGCATTTGATTCATGTTTCTAATCAGTTGGTGGAAGGGATTAGCGGAGATGGAAGTGTAGACCGGTCAAGGGTTAAACACATTCCTGCGATTAAGCATTATGTCAGAACTGATAATGGGTCTTTCTATGTGAGCCTCTCATCTTGA


Protein sequences

Name Description Sequence
NBS/LRR disease resistance protein RPM1 NBS/LRR disease resistance protein RPM1 [Arabidopsis lyrata].

MASATVDFGIGRILSVLENETLLLSGVHVEIDKMKKELLIMKSFLEDTHQHGGNGSIATTTQVFQTFVANTRDRRHSRRVWLSHPRYRSCAKLWRAFHFPRYMWARHSIAQKLGVVNVMIQSISDSMKRYYHSENYQAAILSPTDDGDAKWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFECYAWVTISKSYEIEDVFRTMIKEFYKEAETQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPGSLEQCRTQNLEPIARKLLERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNLELKIVRSILLLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLVRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETIENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMDLLPSLKLLRALDLEDSAISKLPDCLVTMFNLKYLNLSKTQVKELPKDFHKLINLETLNTKHSKIEELPPGMWKLQKLRYLITFRRNDGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEAELIKNLGNMTQLTRISLVMVRREHGRDLCDSLNKIRRLRFLSLTSIHEEEPLEIDDLIATASIEKLFLAGKLERVPIWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLCFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYIRACRGLESVPKGIENLINLQELHLIHVSNQLVEGISGDGSVDRSRVKHIPAIKHYVRTDNGSFYVSLSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF234
2-921 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

ASATVDFGIGRILSVLENETLLLSGVHVEIDKMKKELLIMKSFLEDTHQHGGNGSIATTTQVFQTFVANTRDRRHSRRVWLSHPRYRSCAKLWRAFHFPRYMWARHSIAQKLGVVNVMIQSISDSMKRYYHSENYQAAILSPTDDGDAKWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFECYAWVTISKSYEIEDVFRTMIKEFYKEAETQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPGSLEQCRTQNLEPIARKLLERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNLELKIVRSILLLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLVRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETIENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMDLLPSLKLLRALDLEDSAISKLPDCLVTMFNLKYLNLSKTQVKELPKDFHKLINLETLNTKHSKIEELPPGMWKLQKLRYLITFRRNDGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEAELIKNLGNMTQLTRISLVMVRREHGRDLCDSLNKIRRLRFLSLTSIHEEEPLEIDDLIATASIEKLFLAGKLERVPIWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLCFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYIRACRGLESVPKGIENLINLQELHLIHVSNQLVEGISGDGSVDRSRVKHIPAIKHYVRTDNGSFYVSLSS

HMMPanther: PTHR23155
2-921 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASATVDFGIGRILSVLENETLLLSGVHVEIDKMKKELLIMKSFLEDTHQHGGNGSIATTTQVFQTFVANTRDRRHSRRVWLSHPRYRSCAKLWRAFHFPRYMWARHSIAQKLGVVNVMIQSISDSMKRYYHSENYQAAILSPTDDGDAKWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFECYAWVTISKSYEIEDVFRTMIKEFYKEAETQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPGSLEQCRTQNLEPIARKLLERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNLELKIVRSILLLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLVRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETIENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMDLLPSLKLLRALDLEDSAISKLPDCLVTMFNLKYLNLSKTQVKELPKDFHKLINLETLNTKHSKIEELPPGMWKLQKLRYLITFRRNDGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEAELIKNLGNMTQLTRISLVMVRREHGRDLCDSLNKIRRLRFLSLTSIHEEEPLEIDDLIATASIEKLFLAGKLERVPIWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLCFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYIRACRGLESVPKGIENLINLQELHLIHVSNQLVEGISGDGSVDRSRVKHIPAIKHYVRTDNGSFYVSLSS

superfamily: SSF52540
150-406 SSF52540

KWVNNISESSLFFSENSLVGIDAPKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFECYAWVTISKSYEIEDVFRTMIKEFYKEAETQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPGSLEQCRTQNLEPIARKLLERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNL

HMMPfam: PF00931
IPR002182
172-460 NB-ARC,NBS
NB-ARC

APKGKLIGRLLSPEPQRIVVAVVGMGGSGKTTLSANIFKSQSVRRHFECYAWVTISKSYEIEDVFRTMIKEFYKEAETQIPAELYSLGYRELVEKLVEYLQSKRYIVVLDDVWTTGLWREISIALPDGIYGSRVMMTTRDMNVASFPYGIGSTKHEIELLKEDEAWVLFSNKAFPGSLEQCRTQNLEPIARKLLERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNLELKIVRSILLLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLVRMWMAQRFVEPI

Gene3D: G3DSA:3.40.50.300
185-213 G3DSA:3.40.50.300

EPQRIVVAVVGMGGSGKTTLSANIFKSQS

FPrintScan: PR00364
IPR000767
190-205 DISEASERSIST
Disease resistance protein

VVAVVGMGGSGKTTLS

FPrintScan: PR00364
IPR000767
270-284 DISEASERSIST
Disease resistance protein

YLQSKRYIVVLDDVW

FPrintScan: PR00364
IPR000767
368-382 DISEASERSIST
Disease resistance protein

CQGLPLAIASLGSMM

superfamily: SSF52058
497-878 SSF52058,LRR

KMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETIENYGSRHLCIQKEMTPDSIRATNLHSLLVCSSAKHKMDLLPSLKLLRALDLEDSAISKLPDCLVTMFNLKYLNLSKTQVKELPKDFHKLINLETLNTKHSKIEELPPGMWKLQKLRYLITFRRNDGHDSNWNYVLGTRVVPKIWQLKDLQVMDCFNAEAELIKNLGNMTQLTRISLVMVRREHGRDLCDSLNKIRRLRFLSLTSIHEEEPLEIDDLIATASIEKLFLAGKLERVPIWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLCFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYIRACRGLESVPKGIENLINLQELHLIH

Gene3D: G3DSA:3.80.10.10
552-650 G3DSA:3.80.10.10

RATNLHSLLVCSSAKHKMDLLPSLKLLRALDLEDSAISKLPDCLVTMFNLKYLNLSKTQVKELPKDFHKLINLETLNTKHSKIEELPPGMWKLQKLRYL

FPrintScan: PR00364
IPR000767
573-589 DISEASERSIST
Disease resistance protein

PSLKLLRALDLEDSAIS

HMMPfam: PF13855
600-650 LRR_8,Leucine rich repeat

NLKYLNLSKTQVKELPKDFHKLINLETLNTKHSKIEELPPGMWKLQKLRYL

Gene3D: G3DSA:3.80.10.10
674-880 G3DSA:3.80.10.10

KIWQLKDLQVMDCFNAEAELIKNLGNMTQLTRISLVMVRREHGRDLCDSLNKIRRLRFLSLTSIHEEEPLEIDDLIATASIEKLFLAGKLERVPIWFNTLQNLTYLGLRGSQLQENAILSIQTLPRLVWLSFYNAYMGPRLCFAQGFQNLKILEIVQMKHLTEVVIEDGAMFELQKLYIRACRGLESVPKGIENLINLQELHLIHVS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox