PRGDB00049223 (RPM1)

From PRG Wiki
Jump to: navigation, search
RPM1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4092770 (AF105139)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Brassica napus

Comment?

Brassica napus chromosome N11 GTP-binding protein gene, partial cds; and disease resistance gene homolog 1A (RPM1) gene, complete cds.

DNA Sequence

ATGGCCTCAGCTACTGTTGATGTTGGGATAGGACTGATTCTCAACCTCCTAGAAAACGAGACCTTGTTGCTGTCAGGAGTTCACAGCGAGATCGAGAAGATGAAGAAGGAGTTGCTTATCATAAAGTCCTTTCTTGAGGACACCCATAAACAAGATGGGAATGGATCCACCACCACCACAACAACGGGAACAACAACAACTCAACTCTTTCAAACTTTTGTGGCGAACACAAGAGACTTGGCTTACCAAGTGGAAGACATCATCGACGAGTTCACCTATCACATCCACGGTTATCGAAGCTGCACAAAGCTTCGGCGTGCAGTTCATTTCCCTATGTACATGTGGGCTAGACACTCCATAGCTCAGAAGCTAGGAGCCGTGAATGTCATGATTCGTTCCATTTCTGAATCCATGAAAAGGTACCAAACCTATCAAGGAGCATCAGTATCGCATGTTGATGATGGTGGTGGTACAAAGTGGGTGAATCACATCAGCGAGTCATCTTTGTTCTTTAGTGAAAACAGTCTTGTAGGGATTGATGCAGCTAAAGGAAAGCTCATTGGATGGCTTCTGAGTCCTGAACCTCAGAGGATAGTTGTCTCGGTGGTCGGAATGGGTGGTTCAGGGAAGACTACACTCTCAGCTAACATCTTCAAGTCCCAAACCGTGCGCAAGCATTTCGCGTCATACGCTTGGGTTACTATCTCTAAATCCTATGTGATTGAAGATGTGTTTAGGACAATGATAAAGGAGTTCTACAAAGAAGCAGAAACACAGATTCCAGGTGAGTTGTACTCCTTAACTTACAGAGAGCTGGTTGAGAAGCTTGTGGAGTATTTGCATTCCAAGAGGTACTTTGTTATGCTTGATGATGTGTGGAACACTGGTCTGTGGAGGGAGATAAGCATCGCTCTACCAGATGGTATTAGCGGAAGCCGTGTTATGGTCACTACTCGCAGCAATAACATGGCTTCTTTCTCATATGGCAGTGGGAGTAGAAAGCATGAGATTGAGCTCTTGAAAGAAGACGAGGCTTGGGCGCTTTTCTGCAACAAAGCCTTTTCAGGAAGTCTTGAGGAATGCAGGAGGAGGAATCTAGAGGTGGTAGCAAGGAAGTTAGTTGAGAGATGTCAAGGCCTGCCGTTAGCTATAGCTTCTTTAGGGAGCATGATGTCAACAAAGAGGTTGGAGTCAGAGTGGAAGCAAGTCTACAACTCTTTGAACTGGGAACTGAACAACAATCTTGAGCTCAAGGTTGTTAGAAGCATCTTGTTGCTTAGCTTCAGTGATCTGCCGTATCCGCTTAAACGTTGTTTCTTGTACTGTTGTCTGTTCCCTGTGAACTACCGGATGAAAAGGAAGAAGCTGGTTAGGATGTGGATGGCGCAACGGTTTGTGGAACCGATCAGAGGAGTGAAAGCGGAAGAAGTGGCTGATGGTTACCTCAATGAGCTTGTTTACAGAAACATGCTTCAAGTTATCTTGTGGAATCCTTTTGGACGACCCAAAGTGTTCAAGATGCATGATGTGATCAGGGAGATCGCTCTATCTATATCCAAAGCTGAGAGGTTCTGTGATGTTAATGGTGATGATGATGATGATGATGATGCGGAAACAGCCGAGGATCACGGTACTCGCCATTTATGCATTCAGAAAGAGATGAGATCAGGTACATTACGTAGAACAAACCTTCACACTCTTTTGGTTTGCACTAAACACAGCATTGAACTGCCTCCAAGTCTGAAACTTCTAAGAGCCTTAGACCTTGAAGGCTCTGGCGTCACCAAGCTACCTGACTTTTTGGTAACTCTGTTCAACTTAAAGTACTTGAACTTGTCGAAAACCGAAGTGAAGGAACTCCCAAGAGACTTTCATAGACTCATTAATTTGGAGACTTTGAACACTAGGCACTCCAAGGTTGATGAGCTTCCTCCGGGGATGTGGAAGCTGCGGAAGCTGCGTTATCTGATTACTTTCCGTTGCAACTACGGACATGATTCCAACTGGAACTATGTTTTAGGCACAAAGGTTTCTCCGAGTATCTGCCAGCTGAAGGATTTGCAAGTCATGGACTGCTTCAACGCAGAAGCTGAGCTTATCAAGAAGCTAGGGGGCATGACTCAGCTCACGAGAATAAGCCTTGTCATGATTAAAAGAGAACATGGAAGTGACTTATGCGAGTCGCTGAACAAGATCAAAAGACTCAGATTCTTGTCTCTCACGTCCATTCATGAAGAGGAACCGTTAGAGATAGATGGATTGATAGCAACTGCAAGCATTGAGAAACTCTTTCTAGCAGGGAAACTAGAAAGAGTACCGAGTTGGTTCAGTACTCTTCAGAACGTAACCTATTTGGGTCTGCGCGGATCTCAGCTGCAAGAGAACGCCATTCACTACCTCCAAACCCTTCCTAAACTAGTATGGCTTTCATTTTACAAGGCCTACATGGGGACTAGGTTGTGTTTTGCTGAAGGGTTTGAGAATCTTAAGATTCTAGATATAGTCCAGATGCGACATCTTACAGAAGTTGTGATAGAAGAGGGTGCAATGGTTGGGATACAGAAGCTTTATGTCAGAGCTTGTAGAGTGTTGGAGTCGGTCCCGAGGGGAATAGAGAATCTTGTGAACCTTCAAGAACTGCATTTGAGTCATGTTTCTGATCAGCTAGTGGAGAGGATTCGTGGGGAAGAGGGTGTAGACCGGTGGAGTGTTAAACACATTCCTGCCATCAAGCATCATTTCAGAACTGAGGATGGCTCTTTCTATGTGAGCCTCTCATCTTGA


Protein sequences

Name Description Sequence
disease resistance gene homolog 1A disease resistance gene homolog 1A [Brassica napus].

MASATVDVGIGLILNLLENETLLLSGVHSEIEKMKKELLIIKSFLEDTHKQDGNGSTTTTTTGTTTTQLFQTFVANTRDLAYQVEDIIDEFTYHIHGYRSCTKLRRAVHFPMYMWARHSIAQKLGAVNVMIRSISESMKRYQTYQGASVSHVDDGGGTKWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVMLDDVWNTGLWREISIALPDGISGSRVMVTTRSNNMASFSYGSGSRKHEIELLKEDEAWALFCNKAFSGSLEECRRRNLEVVARKLVERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILLLSFSDLPYPLKRCFLYCCLFPVNYRMKRKKLVRMWMAQRFVEPIRGVKAEEVADGYLNELVYRNMLQVILWNPFGRPKVFKMHDVIREIALSISKAERFCDVNGDDDDDDDAETAEDHGTRHLCIQKEMRSGTLRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKKLGGMTQLTRISLVMIKREHGSDLCESLNKIKRLRFLSLTSIHEEEPLEIDGLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSQLQENAIHYLQTLPKLVWLSFYKAYMGTRLCFAEGFENLKILDIVQMRHLTEVVIEEGAMVGIQKLYVRACRVLESVPRGIENLVNLQELHLSHVSDQLVERIRGEEGVDRWSVKHIPAIKHHFRTEDGSFYVSLSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-927 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASATVDVGIGLILNLLENETLLLSGVHSEIEKMKKELLIIKSFLEDTHKQDGNGSTTTTTTGTTTTQLFQTFVANTRDLAYQVEDIIDEFTYHIHGYRSCTKLRRAVHFPMYMWARHSIAQKLGAVNVMIRSISESMKRYQTYQGASVSHVDDGGGTKWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVMLDDVWNTGLWREISIALPDGISGSRVMVTTRSNNMASFSYGSGSRKHEIELLKEDEAWALFCNKAFSGSLEECRRRNLEVVARKLVERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILLLSFSDLPYPLKRCFLYCCLFPVNYRMKRKKLVRMWMAQRFVEPIRGVKAEEVADGYLNELVYRNMLQVILWNPFGRPKVFKMHDVIREIALSISKAERFCDVNGDDDDDDDAETAEDHGTRHLCIQKEMRSGTLRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKKLGGMTQLTRISLVMIKREHGSDLCESLNKIKRLRFLSLTSIHEEEPLEIDGLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSQLQENAIHYLQTLPKLVWLSFYKAYMGTRLCFAEGFENLKILDIVQMRHLTEVVIEEGAMVGIQKLYVRACRVLESVPRGIENLVNLQELHLSHVSDQLVERIRGEEGVDRWSVKHIPAIKHHFRTEDGSFYVSLSS

HMMPanther: PTHR23155:SF234
2-927 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

ASATVDVGIGLILNLLENETLLLSGVHSEIEKMKKELLIIKSFLEDTHKQDGNGSTTTTTTGTTTTQLFQTFVANTRDLAYQVEDIIDEFTYHIHGYRSCTKLRRAVHFPMYMWARHSIAQKLGAVNVMIRSISESMKRYQTYQGASVSHVDDGGGTKWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVMLDDVWNTGLWREISIALPDGISGSRVMVTTRSNNMASFSYGSGSRKHEIELLKEDEAWALFCNKAFSGSLEECRRRNLEVVARKLVERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILLLSFSDLPYPLKRCFLYCCLFPVNYRMKRKKLVRMWMAQRFVEPIRGVKAEEVADGYLNELVYRNMLQVILWNPFGRPKVFKMHDVIREIALSISKAERFCDVNGDDDDDDDAETAEDHGTRHLCIQKEMRSGTLRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKKLGGMTQLTRISLVMIKREHGSDLCESLNKIKRLRFLSLTSIHEEEPLEIDGLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSQLQENAIHYLQTLPKLVWLSFYKAYMGTRLCFAEGFENLKILDIVQMRHLTEVVIEEGAMVGIQKLYVRACRVLESVPRGIENLVNLQELHLSHVSDQLVERIRGEEGVDRWSVKHIPAIKHHFRTEDGSFYVSLSS

superfamily: SSF52540
159-415 SSF52540

KWVNHISESSLFFSENSLVGIDAAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVMLDDVWNTGLWREISIALPDGISGSRVMVTTRSNNMASFSYGSGSRKHEIELLKEDEAWALFCNKAFSGSLEECRRRNLEVVARKLVERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNL

HMMPfam: PF00931
IPR002182
181-469 NB-ARC,NBS
NB-ARC

AAKGKLIGWLLSPEPQRIVVSVVGMGGSGKTTLSANIFKSQTVRKHFASYAWVTISKSYVIEDVFRTMIKEFYKEAETQIPGELYSLTYRELVEKLVEYLHSKRYFVMLDDVWNTGLWREISIALPDGISGSRVMVTTRSNNMASFSYGSGSRKHEIELLKEDEAWALFCNKAFSGSLEECRRRNLEVVARKLVERCQGLPLAIASLGSMMSTKRLESEWKQVYNSLNWELNNNLELKVVRSILLLSFSDLPYPLKRCFLYCCLFPVNYRMKRKKLVRMWMAQRFVEPI

Gene3D: G3DSA:3.40.50.300
198-219 G3DSA:3.40.50.300

IVVSVVGMGGSGKTTLSANIFK

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

VVSVVGMGGSGKTTLS

FPrintScan: PR00364
IPR000767
279-293 DISEASERSIST
Disease resistance protein

YLHSKRYFVMLDDVW

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

CQGLPLAIASLGSMM

superfamily: SSF52058
506-884 SSF52058,LRR

KMHDVIREIALSISKAERFCDVNGDDDDDDDAETAEDHGTRHLCIQKEMRSGTLRRTNLHTLLVCTKHSIELPPSLKLLRALDLEGSGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYLITFRCNYGHDSNWNYVLGTKVSPSICQLKDLQVMDCFNAEAELIKKLGGMTQLTRISLVMIKREHGSDLCESLNKIKRLRFLSLTSIHEEEPLEIDGLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSQLQENAIHYLQTLPKLVWLSFYKAYMGTRLCFAEGFENLKILDIVQMRHLTEVVIEEGAMVGIQKLYVRACRVLESVPRGIENLVNLQELHLSH

Gene3D: G3DSA:3.80.10.10
567-656 G3DSA:3.80.10.10

LLVCTKHSIELPPSLKLLRALDLEGSGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLNTRHSKVDELPPGMWKLRKLRYL

FPrintScan: PR00364
IPR000767
579-595 DISEASERSIST
Disease resistance protein

PSLKLLRALDLEGSGVT

Gene3D: G3DSA:3.80.10.10
680-884 G3DSA:3.80.10.10

SICQLKDLQVMDCFNAEAELIKKLGGMTQLTRISLVMIKREHGSDLCESLNKIKRLRFLSLTSIHEEEPLEIDGLIATASIEKLFLAGKLERVPSWFSTLQNVTYLGLRGSQLQENAIHYLQTLPKLVWLSFYKAYMGTRLCFAEGFENLKILDIVQMRHLTEVVIEEGAMVGIQKLYVRACRVLESVPRGIENLVNLQELHLSH


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox