PRGDB00049240 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3075473 (AF039382)
Gene Class CNL
Domain Type NBS, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone L3 putative disease resistance protein gene, partial cds.

DNA Sequence

CTCGCGAGACAAGTTTTTCATCATGACATTGTCCGACGCCATTTTGATGGATTCTCATGGGTTTGTGTATCGCAACAGTTTACGCGAAAAGATGTTTGGCAGAGGATCTTGCAAGATCTTAGACCATATGATGAGGGCATTATACAGACGGACGAATATACACTCCAAGGTGAACTCTTTGAGTTGTTGGAAAGCGGTAGATATCTGCTTGTCCTTGATGATGTATGGAAAGAAGAAGACTGGGACCGAATAAAAGCGGTGTTTCCACATAAAAGAGGTTGGAAAATGTTACTTACTTCTCGCAATGAAGGTCTTGGTTTACATGCGGATCCAACATGTTTTGCCTTTAGACCAAGAATCCTTACTCCCGAACAAAGTTGGAAGCTATTTGAGAGGATAGTAAGCTCTAGGAGAGACAAAACTGCAGAATTCAAGGTTGATGAAGCCATGGGAAAGGAGATGGTCACATATTGTGGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

LARQVFHHDIVRRHFDGFSWVCVSQQFTRKDVWQRILQDLRPYDEGIIQTDEYTLQGELFELLESGRYLLVLDDVWKEEDWDRIKAVFPHKRGWKMLLTSRNEGLGLHADPTCFAFRPRILTPEQSWKLFERIVSSRRDKTAEFKVDEAMGKEMVTYCG


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-158 NB-ARC,NBS
NB-ARC

LARQVFHHDIVRRHFDGFSWVCVSQQFTRKDVWQRILQDLRPYDEGIIQTDEYTLQGELFELLESGRYLLVLDDVWKEEDWDRIKAVFPHKRGWKMLLTSRNEGLGLHADPTCFAFRPRILTPEQSWKLFERIVSSRRDKTAEFKVDEAMGKEMVTYC

HMMPanther: PTHR23155
1-94 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LARQVFHHDIVRRHFDGFSWVCVSQQFTRKDVWQRILQDLRPYDEGIIQTDEYTLQGELFELLESGRYLLVLDDVWKEEDWDRIKAVFPHKRGW

superfamily: SSF52540
1-159 P-loop containing nucleoside triphosphate hydrolases

LARQVFHHDIVRRHFDGFSWVCVSQQFTRKDVWQRILQDLRPYDEGIIQTDEYTLQGELFELLESGRYLLVLDDVWKEEDWDRIKAVFPHKRGWKMLLTSRNEGLGLHADPTCFAFRPRILTPEQSWKLFERIVSSRRDKTAEFKVDEAMGKEMVTYCG

HMMPanther: PTHR23155:SF231
1-94 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LARQVFHHDIVRRHFDGFSWVCVSQQFTRKDVWQRILQDLRPYDEGIIQTDEYTLQGELFELLESGRYLLVLDDVWKEEDWDRIKAVFPHKRGW


List of References

M G Aarts, B te Lintel Hekkert, E B Holub, J L Beynon, W J Stiekema, A Pereira
Identification of R-gene homologous DNA fragments genetically linked to disease resistance loci in Arabidopsis thaliana.
Mol. Plant Microbe Interact.: 1998, 11(4);251-8
PubMed:9530866 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox