PRGDB00049274 (VRP1-3)

From PRG Wiki
Jump to: navigation, search
VRP1-3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 189096589 (EU669439)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, RPW8, Others
Gene Species Vitis hybrid cultivar

Comment?

Vitis hybrid cultivar Regent VRP1-1, VRP1-2, and VRP1-3 genes, complete cds.

DNA Sequence

ATGGAAATTGTTGGAGAAGCCGTTCTGGAAAAAATCATTGGAGAATTGATAAAACCCATTTTCGATGTAGGAAAGAAGGCAGCTGCGTTCGGTGAGATCTTAAAACGAGTCAAATCCATTCTGAAACTCATAGAGCCGACCGTTCATCAGATCAAACAATCGAGCGGAGAGAGGGATCGTCCAAAGGAGGAGAGCGAGAAGCAGCTAATACAACGGTATGAAGAAGGCAAGAAGCTTATTCAAAACTACTATAGGGCCCATTGGTTGTTCAAGAATAGGAAATACGAAGGTAAGATTACTGCCTTTTACGAGTCGCTTATTCTCCTCTTCAAGTTCCGTATGCCTCTGGAACAATTTAATACCATCAGGGAGATTTTGGCCCTTCTTCAATCTCAATTGAAATCTGGAACTGGTGAGGTGTCTGGTCAAATTGGATATTTGGGTTCGGGAGATTGCTATGCCCCTGAACCCCCTGCTTTTACGGTGGGACTGGATGTGCCCCTGAGAGAAGTGAAAGAGCTGCTGTTCAAAGAATCTGTGGTTGTGGTGTCGGCTCCTGGAGGATGTGGGAAGACCACACTCGTTCAAAAACTTTGCCAAGACCCGGATGTTAAAGGAAAATTTAAGGACAACATCTTCTTTGTCACCGTATCTAAGGCGCCCAACATCAAACTCATGGTACGGGAACTATTTGAACATAATCATCGCCCGGTGCCAGAGTTTCAAACTGATCAACATGCGATCAAAGAGTTGAAACGACTGCTGACAGAACAAGCAGAAAAAGCTCCTGTACTGTTGGTCCTCGATGATGTTTGGGGTGGCCCTGATATTAGGGTTGAACCTGAATTCCCTCTTCAGGAGTTTAAAAAGTTTGAAATACCGGAATTCAGGATTCTGGTTACATCAAGATACAAATTTCCAGGCTTTGGCTCTGCCTACAAACTGAACTTGTTGCATGGTGAAGAAGCCATGAAACTTTTTCGGCACTTAGCATTCCCCACAGATGGGGATTTCACGCTGGATGAAGATTTTGATGAAGATCTTGTGAAGGAGATTGTGAAAAGATGCGGTGGATTCCCTCTGGCCCTCCAAGTTGTAGCCCGATCACTCTGTGGGCTACCTGTAGAGATCTGGAAAAGCAGACTGCTGGAATGGTCGGAAGGTCAATCCATTTTGGAATCTGGGGCAGGTCTTCTTGATTGCCTCCAAAGTAGCTTAGCTTCCTTGAAGGATAAGCTGAAGGAGTGCTTTATGGACCTGGGCTCATTTCCTGAGGATAAAAAAATACCTGTCACGGCTCTTATAGATATGTGGGCAGAATTGTACAAACCCGATAAAAATGGCGTGCATGCTATTTCCAGACTTATTGAACTCTCCTTACAGAGTCTGCTTAATCTGGTAGTCACCAGGAAAGGCGCAACAGAGGTTGAAGGCTGCTATGACGACGCCTTTGTCTTGCAACATGATCTTCTGAGAGAACTGGCCATTCGTCAGAGCAGCCAGGAGTCCATGGAAGAGAGGAAAAGACTAATCTTGGATTTCAGTGGAAACGAGCTCCCTGATTGGTGGACAGAAGAAAAACAACCCTGCATCAGGGCTCGCCTTCTGTCTATCTCCACAGACGAAATGTTCTCCTCAAGCTGGTGCGACATGCAAGTGCCTGAAGTGGAGGTCCTGATACTCAACTTTCAGACAAGGGAAAACAACTACACACTACCAGAGTTCATGAAGCGAATGGATAAGTTGAAGGTCTTGGTATTAACAAATTATGGTTTCTCCATTCCTGAGCTGACTAATTTTTCAGTCCTCGGTTCTTTATCCAGTCTAAAGAGAATCAGGTTAGAGCGGGTTTCAATCCCAGCCCTCTGCAACACCATGGTAGAGTTAAAGAATTTGGAGAAAATAACCTTGGTTATGTGTAAGATCAATCAGGCTTTTAACAGTAGTGCCATCCAGATGCCTGTTATGTTGCCTAATCTTAAGGAAATAAATATTGATTCCTGCAATGACTTGGTGGGGTTACCTGAGTGGCTCTGTGATTTAGTACAGCTAAGGAAGCTCAGCATCTCCAACTGCCATAAGCCATCTACACTGCCAGAAGGGATGGGGAGGCTGGGAAATCTGGAGGTGCTGAGGCTTCATGCTTGCACAAAACTATTGGGATTGCCAGACTCAATCGGAGGTCTCCACAAGTTGACTGTTCTTGATATTACTGGTTGTCTTCGGATGACGAAACTGCCAAAACAAATGGGTAAGTTGTGTAGCTTGAGCATGCTCTACATGAGAAGGTGCTCAGGTTTGAGAGAGTTGCCACCATCAATCATGGATCTGAAGCAGTTGAAGAAAGTAATCTGTGACACAGAGACAGCCAAGCTGTGGGAAGAGCACCATTTCACCAATTTGAAGATTGACGACACAGTTGACTTAGATTGGCTTCGTTGA


Protein sequences

Name Description Sequence
VRP1-3 VRP1-3 [Vitis hybrid cultivar].

MEIVGEAVLEKIIGELIKPIFDVGKKAAAFGEILKRVKSILKLIEPTVHQIKQSSGERDRPKEESEKQLIQRYEEGKKLIQNYYRAHWLFKNRKYEGKITAFYESLILLFKFRMPLEQFNTIREILALLQSQLKSGTGEVSGQIGYLGSGDCYAPEPPAFTVGLDVPLREVKELLFKESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGGPDIRVEPEFPLQEFKKFEIPEFRILVTSRYKFPGFGSAYKLNLLHGEEAMKLFRHLAFPTDGDFTLDEDFDEDLVKEIVKRCGGFPLALQVVARSLCGLPVEIWKSRLLEWSEGQSILESGAGLLDCLQSSLASLKDKLKECFMDLGSFPEDKKIPVTALIDMWAELYKPDKNGVHAISRLIELSLQSLLNLVVTRKGATEVEGCYDDAFVLQHDLLRELAIRQSSQESMEERKRLILDFSGNELPDWWTEEKQPCIRARLLSISTDEMFSSSWCDMQVPEVEVLILNFQTRENNYTLPEFMKRMDKLKVLVLTNYGFSIPELTNFSVLGSLSSLKRIRLERVSIPALCNTMVELKNLEKITLVMCKINQAFNSSAIQMPVMLPNLKEINIDSCNDLVGLPEWLCDLVQLRKLSISNCHKPSTLPEGMGRLGNLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMTKLPKQMGKLCSLSMLYMRRCSGLRELPPSIMDLKQLKKVICDTETAKLWEEHHFTNLKIDDTVDLDWLR

Domains

Domain Start-End Description Sequence

HMMPfam: PF05659
IPR008808
2-130 RPW8
Powdery mildew resistance protein, RPW8 domain

EIVGEAVLEKIIGELIKPIFDVGKKAAAFGEILKRVKSILKLIEPTVHQIKQSSGERDRPKEESEKQLIQRYEEGKKLIQNYYRAHWLFKNRKYEGKITAFYESLILLFKFRMPLEQFNTIREILALLQ

superfamily: SSF52540
157-384 SSF52540

PPAFTVGLDVPLREVKELLFKESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGGPDIRVEPEFPLQEFKKFEIPEFRILVTSRYKFPGFGSAYKLNLLHGEEAMKLFRHLAFPTDGDFTLDEDFDEDLVKEIVKRCGGFPLALQVVARSLCGLPVEIWKSRLLE

HMMPanther: PTHR23155:SF239
162-780 PTHR23155:SF239,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VGLDVPLREVKELLFKESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGGPDIRVEPEFPLQEFKKFEIPEFRILVTSRYKFPGFGSAYKLNLLHGEEAMKLFRHLAFPTDGDFTLDEDFDEDLVKEIVKRCGGFPLALQVVARSLCGLPVEIWKSRLLEWSEGQSILESGAGLLDCLQSSLASLKDKLKECFMDLGSFPEDKKIPVTALIDMWAELYKPDKNGVHAISRLIELSLQSLLNLVVTRKGATEVEGCYDDAFVLQHDLLRELAIRQSSQESMEERKRLILDFSGNELPDWWTEEKQPCIRARLLSISTDEMFSSSWCDMQVPEVEVLILNFQTRENNYTLPEFMKRMDKLKVLVLTNYGFSIPELTNFSVLGSLSSLKRIRLERVSIPALCNTMVELKNLEKITLVMCKINQAFNSSAIQMPVMLPNLKEINIDSCNDLVGLPEWLCDLVQLRKLSISNCHKPSTLPEGMGRLGNLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMTKLPKQMGKLCSLSMLYMRRCSGLRELPPSIMDLKQL

HMMPanther: PTHR23155
162-780 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGLDVPLREVKELLFKESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGGPDIRVEPEFPLQEFKKFEIPEFRILVTSRYKFPGFGSAYKLNLLHGEEAMKLFRHLAFPTDGDFTLDEDFDEDLVKEIVKRCGGFPLALQVVARSLCGLPVEIWKSRLLEWSEGQSILESGAGLLDCLQSSLASLKDKLKECFMDLGSFPEDKKIPVTALIDMWAELYKPDKNGVHAISRLIELSLQSLLNLVVTRKGATEVEGCYDDAFVLQHDLLRELAIRQSSQESMEERKRLILDFSGNELPDWWTEEKQPCIRARLLSISTDEMFSSSWCDMQVPEVEVLILNFQTRENNYTLPEFMKRMDKLKVLVLTNYGFSIPELTNFSVLGSLSSLKRIRLERVSIPALCNTMVELKNLEKITLVMCKINQAFNSSAIQMPVMLPNLKEINIDSCNDLVGLPEWLCDLVQLRKLSISNCHKPSTLPEGMGRLGNLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMTKLPKQMGKLCSLSMLYMRRCSGLRELPPSIMDLKQL

Gene3D: G3DSA:3.40.50.300
164-274 G3DSA:3.40.50.300

LDVPLREVKELLFKESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGG

HMMPfam: PF00931
IPR002182
170-440 NB-ARC,NBS
NB-ARC

EVKELLFKESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGGPDIRVEPEFPLQEFKKFEIPEFRILVTSRYKFPGFGSAYKLNLLHGEEAMKLFRHLAFPTDGDFTLDEDFDEDLVKEIVKRCGGFPLALQVVARSLCGLPVEIWKSRLLEWSEGQSILESGAGLLDCLQSSLASLKDKLKECFMDLGSFPEDKKIPVTALIDMWAE

HMMSmart: SM00382
IPR003593
177-336 AAA,NBS
AAA+ ATPase domain

KESVVVVSAPGGCGKTTLVQKLCQDPDVKGKFKDNIFFVTVSKAPNIKLMVRELFEHNHRPVPEFQTDQHAIKELKRLLTEQAEKAPVLLVLDDVWGGPDIRVEPEFPLQEFKKFEIPEFRILVTSRYKFPGFGSAYKLNLLHGEEAMKLFRHLAFPTDG

FPrintScan: PR00364
IPR000767
180-195 DISEASERSIST
Disease resistance protein

VVVVSAPGGCGKTTLV

FPrintScan: PR00364
IPR000767
258-272 DISEASERSIST
Disease resistance protein

QAEKAPVLLVLDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CGGFPLALQVVARSL

superfamily: SSF52047
507-783 SSF52047,LRR

RKRLILDFSGNELPDWWTEEKQPCIRARLLSISTDEMFSSSWCDMQVPEVEVLILNFQTRENNYTLPEFMKRMDKLKVLVLTNYGFSIPELTNFSVLGSLSSLKRIRLERVSIPALCNTMVELKNLEKITLVMCKINQAFNSSAIQMPVMLPNLKEINIDSCNDLVGLPEWLCDLVQLRKLSISNCHKPSTLPEGMGRLGNLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMTKLPKQMGKLCSLSMLYMRRCSGLRELPPSIMDLKQLKKV

Gene3D: G3DSA:3.80.10.10
552-783 G3DSA:3.80.10.10

QVPEVEVLILNFQTRENNYTLPEFMKRMDKLKVLVLTNYGFSIPELTNFSVLGSLSSLKRIRLERVSIPALCNTMVELKNLEKITLVMCKINQAFNSSAIQMPVMLPNLKEINIDSCNDLVGLPEWLCDLVQLRKLSISNCHKPSTLPEGMGRLGNLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMTKLPKQMGKLCSLSMLYMRRCSGLRELPPSIMDLKQLKKV

FPrintScan: PR00364
IPR000767
655-671 DISEASERSIST
Disease resistance protein

VMLPNLKEINIDSCNDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox