PRGDB00049276 (VRP1-1)

From PRG Wiki
Jump to: navigation, search
VRP1-1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 189096589 (EU669439)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, RPW8, Others
Gene Species Vitis hybrid cultivar

Comment?

Vitis hybrid cultivar Regent VRP1-1, VRP1-2, and VRP1-3 genes, complete cds.

DNA Sequence

ATGGCTTTGGAAACTGTCGGAGGGGTCGTGCTGGACAAAGTTATAGGAGAATTGATAAAACCCTTTGTGGATGGAGGAAAGAAGCAAGCTGCGTTCGGTGACATCTTACAACGAGTCAAGTCCATTATCAAACTCATAGGGCCGACCGTCCGTCAGATCAAAAAATTGAGCGCAGAGTTGGATCGTCCAAAGGAGGAAAGTGAGAACTTAATCCAACTGTTTGATGAAGGCGAGAAGCTTATTCAAAAATGCTCTAAGCTCAATTGGTGGATGCCCAATCGCTGGAAATACGCCAATAAGCTTACTGCCTTTTACGAGTCTCTTCTTCGCTTCTTCCAGTTCCATATGCCGCTGCAACAATTTATGACCAACATGGAGATTTTGGCCCATCTGCAATCTCAATTCAGATCTGGAACTGGTGGGGTTTCTGGTCAAATGGGGTATTTGGGTTCGGGAGGTAGTCGGGTTTCTGGTGAGATTGGATACTTGGATCCTTGCAATGCCCCTGACCCCCCTGATTTTATGGTGGGACTGGATGTGCCTCTGAAAGAAGTGAAAAAGCGGCTGTTCAAGGATGATACATCAGTGATTGTGGTATCGGCACCTGGAGGATGTGGGAAGACCACACTGGTTCAAAAACTTTGTCAAGACCCGGATGTTAAAGAAAATTTTAAGGACAACATCTTCTATGTCACCGTGTCCAAGGTGCACAACCTAAAACTCATAGTACGGAAACTATTTGAACATAATGGTTTCCGGGTGCCTGAGTTTCAAACTGATGAAGATGCAATCAACCAGTTGGAACAACTGCTGAAAAACCAAGCAAGAAAAGCTCCTATACTGTTGGTCCTTGATGATGTTTGGAAGGAACCTGAATTCCCTCTTCAGAAGTTTGCATTTAAAATACCAGAATACAGGATTCTGGTTACATCAAGATATGAATTTCCAAGCTTTGGCTCTACCTACAAACTGAAATTGTTGAATGATGAAGATGCCATGAAGCTTTTTCGGCACTCAGCATTCCTGACAGATGGGGATTTCATGCCGGATGAAGATTTTGATGAAGATCTTGTGAATGAGATTGTGAAAAGGTGCGGGGGATTCCCTCTGGCCCTCCAAGTCATTGGCGGATCACTCTGTGGGCAACCAGTAGAGATCTGGAAAAGCAGACTGATGGAATTTTCGAAAGGTCAATCCATTTTCGATTCTGGGAAACGTCTTCTTGATTGCCTCCAACTTAGCTTAACTTCCTTGGATGATATGTGGGCAGAATTGTACAAACTCGATAAAAATGGTGTGCAGGCTATTTCCAACCTTCATAAACTCTCCTTACAGAATCTGCTCAAACTGGTAGTCACAAGGAAAGATGCAACTGAGGTTGATGGCTACTATGACGAGGCCTTTGTCTTGCAACATGACCTTCTCAGAGACCTAGCCATGCATGAGAGCAGCCAGGAACCTATGGAACAAAGGAAAAGACTAATCCTTGACTTGAGTGGAAATAAGCTCCCTGAGTGGTGGACTGAAGAAAAACAACCCTGCTTCAAGGCTCGGCTTATGTCAATCTCCACAGACCAAATGTTCTCTTCAAGCTGGTGCAACATGCAAGTGCCTGAAGTGGAGGTTCTGATACTCAACTTTCAGGCAACGGAAAACTACACATTCCCGAACTTCATGAAGCAAATGGATAATTTGAAGGTCTTAATAGTAACAAATTATGGTTCCAGTGCTGCTGAGCTGATTAATTTTTCAGTCCTCGGTTCTTTATCCCGTCTAAAGAGAATCAGGTTAGAGCAGGTTTCAATACCAACCCTCTGCGACACCATGGTAGAGTTAAAGAATGTGGAGAAAATATCCTTGGTTATGTGTAAGATCAATCAGGCTTTTAACAGTTGTGCCATCCAGATTTCCAACATGTTGCCGAATCTTATGGAAATAAATATCAGCTACTGCAGTGACCTGGTGGGATTACCTGAGGGGCTCTGTGATTTAGTCCATCTAAAGAAGCTCAGCATCTCCAACTGCCATAAGCTATCTGCACTGCCAGGAGGAATCGGGAGGCTGGAAAATCTTGAAGTGCTGAGGCTTCATGCTTGCACAAAACTATTGGGATTGCCAGACTCAATCGGAGGCCTCCACAAGTTGACTGTTCTTGATATTACTGGTTGTCTTCGGATGGCGAAACTGCCAAAACAAATGGGTAAGTTGTGTAGCTTGAGAAAGCTCTACATGAGAAGGTGCTCAGGTTTGAGAGAGCTGCCACCATCAATCATGGATCTGAAGCAGTTGAAGAAAGTAATCTGTGACATAGAGACGGCCGAGCTGTGGGAAGAGCACCATTTCACCAATTTGAAGATAACAATACCCGAAGAGACTATTGATTTAAATTGGCTTTGA


Protein sequences

Name Description Sequence
VRP1-1 VRP1-1 [Vitis hybrid cultivar].

MALETVGGVVLDKVIGELIKPFVDGGKKQAAFGDILQRVKSIIKLIGPTVRQIKKLSAELDRPKEESENLIQLFDEGEKLIQKCSKLNWWMPNRWKYANKLTAFYESLLRFFQFHMPLQQFMTNMEILAHLQSQFRSGTGGVSGQMGYLGSGGSRVSGEIGYLDPCNAPDPPDFMVGLDVPLKEVKKRLFKDDTSVIVVSAPGGCGKTTLVQKLCQDPDVKENFKDNIFYVTVSKVHNLKLIVRKLFEHNGFRVPEFQTDEDAINQLEQLLKNQARKAPILLVLDDVWKEPEFPLQKFAFKIPEYRILVTSRYEFPSFGSTYKLKLLNDEDAMKLFRHSAFLTDGDFMPDEDFDEDLVNEIVKRCGGFPLALQVIGGSLCGQPVEIWKSRLMEFSKGQSIFDSGKRLLDCLQLSLTSLDDMWAELYKLDKNGVQAISNLHKLSLQNLLKLVVTRKDATEVDGYYDEAFVLQHDLLRDLAMHESSQEPMEQRKRLILDLSGNKLPEWWTEEKQPCFKARLMSISTDQMFSSSWCNMQVPEVEVLILNFQATENYTFPNFMKQMDNLKVLIVTNYGSSAAELINFSVLGSLSRLKRIRLEQVSIPTLCDTMVELKNVEKISLVMCKINQAFNSCAIQISNMLPNLMEINISYCSDLVGLPEGLCDLVHLKKLSISNCHKLSALPGGIGRLENLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMAKLPKQMGKLCSLRKLYMRRCSGLRELPPSIMDLKQLKKVICDIETAELWEEHHFTNLKITIPEETIDLNWL

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-150 RPW8
Powdery mildew resistance protein, RPW8 domain

MALETVGGVVLDKVIGELIKPFVDGGKKQAAFGDILQRVKSIIKLIGPTVRQIKKLSAELDRPKEESENLIQLFDEGEKLIQKCSKLNWWMPNRWKYANKLTAFYESLLRFFQFHMPLQQFMTNMEILAHLQSQFRSGTGGVSGQMGYLG

HMMPfam: PF05659
IPR008808
4-132 RPW8
Powdery mildew resistance protein, RPW8 domain

ETVGGVVLDKVIGELIKPFVDGGKKQAAFGDILQRVKSIIKLIGPTVRQIKKLSAELDRPKEESENLIQLFDEGEKLIQKCSKLNWWMPNRWKYANKLTAFYESLLRFFQFHMPLQQFMTNMEILAHLQ

superfamily: SSF52540
157-393 SSF52540

SGEIGYLDPCNAPDPPDFMVGLDVPLKEVKKRLFKDDTSVIVVSAPGGCGKTTLVQKLCQDPDVKENFKDNIFYVTVSKVHNLKLIVRKLFEHNGFRVPEFQTDEDAINQLEQLLKNQARKAPILLVLDDVWKEPEFPLQKFAFKIPEYRILVTSRYEFPSFGSTYKLKLLNDEDAMKLFRHSAFLTDGDFMPDEDFDEDLVNEIVKRCGGFPLALQVIGGSLCGQPVEIWKSRLME

HMMPanther: PTHR23155:SF239
175-763 PTHR23155:SF239,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

MVGLDVPLKEVKKRLFKDDTSVIVVSAPGGCGKTTLVQKLCQDPDVKENFKDNIFYVTVSKVHNLKLIVRKLFEHNGFRVPEFQTDEDAINQLEQLLKNQARKAPILLVLDDVWKEPEFPLQKFAFKIPEYRILVTSRYEFPSFGSTYKLKLLNDEDAMKLFRHSAFLTDGDFMPDEDFDEDLVNEIVKRCGGFPLALQVIGGSLCGQPVEIWKSRLMEFSKGQSIFDSGKRLLDCLQLSLTSLDDMWAELYKLDKNGVQAISNLHKLSLQNLLKLVVTRKDATEVDGYYDEAFVLQHDLLRDLAMHESSQEPMEQRKRLILDLSGNKLPEWWTEEKQPCFKARLMSISTDQMFSSSWCNMQVPEVEVLILNFQATENYTFPNFMKQMDNLKVLIVTNYGSSAAELINFSVLGSLSRLKRIRLEQVSIPTLCDTMVELKNVEKISLVMCKINQAFNSCAIQISNMLPNLMEINISYCSDLVGLPEGLCDLVHLKKLSISNCHKLSALPGGIGRLENLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMAKLPKQMGKLCSLRKLYMRRCSGLRELPPSIMDLKQL

HMMPanther: PTHR23155
175-763 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVGLDVPLKEVKKRLFKDDTSVIVVSAPGGCGKTTLVQKLCQDPDVKENFKDNIFYVTVSKVHNLKLIVRKLFEHNGFRVPEFQTDEDAINQLEQLLKNQARKAPILLVLDDVWKEPEFPLQKFAFKIPEYRILVTSRYEFPSFGSTYKLKLLNDEDAMKLFRHSAFLTDGDFMPDEDFDEDLVNEIVKRCGGFPLALQVIGGSLCGQPVEIWKSRLMEFSKGQSIFDSGKRLLDCLQLSLTSLDDMWAELYKLDKNGVQAISNLHKLSLQNLLKLVVTRKDATEVDGYYDEAFVLQHDLLRDLAMHESSQEPMEQRKRLILDLSGNKLPEWWTEEKQPCFKARLMSISTDQMFSSSWCNMQVPEVEVLILNFQATENYTFPNFMKQMDNLKVLIVTNYGSSAAELINFSVLGSLSRLKRIRLEQVSIPTLCDTMVELKNVEKISLVMCKINQAFNSCAIQISNMLPNLMEINISYCSDLVGLPEGLCDLVHLKKLSISNCHKLSALPGGIGRLENLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMAKLPKQMGKLCSLRKLYMRRCSGLRELPPSIMDLKQL

HMMPfam: PF00931
IPR002182
182-420 NB-ARC,NBS
NB-ARC

LKEVKKRLFKDDTSVIVVSAPGGCGKTTLVQKLCQDPDVKENFKDNIFYVTVSKVHNLKLIVRKLFEHNGFRVPEFQTDEDAINQLEQLLKNQARKAPILLVLDDVWKEPEFPLQKFAFKIPEYRILVTSRYEFPSFGSTYKLKLLNDEDAMKLFRHSAFLTDGDFMPDEDFDEDLVNEIVKRCGGFPLALQVIGGSLCGQPVEIWKSRLMEFSKGQSIFDSGKRLLDCLQLSLTSLDD

Gene3D: G3DSA:3.40.50.300
191-288 G3DSA:3.40.50.300

KDDTSVIVVSAPGGCGKTTLVQKLCQDPDVKENFKDNIFYVTVSKVHNLKLIVRKLFEHNGFRVPEFQTDEDAINQLEQLLKNQARKAPILLVLDDVW

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VIVVSAPGGCGKTTLV

FPrintScan: PR00364
IPR000767
274-288 DISEASERSIST
Disease resistance protein

QARKAPILLVLDDVW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

CGGFPLALQVIGGSL

superfamily: SSF52047
491-766 SSF52047,LRR

RKRLILDLSGNKLPEWWTEEKQPCFKARLMSISTDQMFSSSWCNMQVPEVEVLILNFQATENYTFPNFMKQMDNLKVLIVTNYGSSAAELINFSVLGSLSRLKRIRLEQVSIPTLCDTMVELKNVEKISLVMCKINQAFNSCAIQISNMLPNLMEINISYCSDLVGLPEGLCDLVHLKKLSISNCHKLSALPGGIGRLENLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMAKLPKQMGKLCSLRKLYMRRCSGLRELPPSIMDLKQLKKV

Gene3D: G3DSA:3.80.10.10
496-507 G3DSA:3.80.10.10

LDLSGNKLPEWW

Gene3D: G3DSA:3.80.10.10
554-765 G3DSA:3.80.10.10

TFPNFMKQMDNLKVLIVTNYGSSAAELINFSVLGSLSRLKRIRLEQVSIPTLCDTMVELKNVEKISLVMCKINQAFNSCAIQISNMLPNLMEINISYCSDLVGLPEGLCDLVHLKKLSISNCHKLSALPGGIGRLENLEVLRLHACTKLLGLPDSIGGLHKLTVLDITGCLRMAKLPKQMGKLCSLRKLYMRRCSGLRELPPSIMDLKQLKK

FPrintScan: PR00364
IPR000767
686-702 DISEASERSIST
Disease resistance protein

GRLENLEVLRLHACTKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox