PRGDB00049296 (I2)

From PRG Wiki
Jump to: navigation, search
I2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77641458 (DQ206212)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum clone 3145 I2 (I2) gene, partial cds.

DNA Sequence

ACTAGAGGACCTCCAACTTCTTTGTTTGATGAATCTGATATCTTTGGTAGGCAGACTGAAATAGAGACTTTGGTTGACCGTTTATTGTCTGTTGATGCCGATGGAAAAAAGTATCGTGTAATTCCTATTGTTGGAATGGCGGGGGTTGGCAAGACAACACTTGCTAAAGCTGTGTACAATAACGAGAAGTTGAAAGATCGTTTTGATTTGAAAGCTTGGATATGTGTGTCTGAACCATATGATGCTTCTAGAATAACAAAAGGATTACTTGAAGAAATTGGTTCATCCAACTTGATGGTTGATAACACTCTTAATCAGCTTCAAATCAAATTGAAGGAAAGCTTAAAAGGGAAAAAGTTTCTTATTGTTTTAGATGATGTTTGGAATGACAAGTACATCGAGTGGGATGACTTGAGAAATCCTTTTGCACCAGGAGAAATTGGAAGTAAGATCATTGTGACGACACGTAAGGAGAGTGTTGCGGAGATGATGGGTAGTCGGCCAATTATCATGGAGATTCTTTCTAGCGAATTCTCTTGGCCTTTATTCAAAAGACTTGCATTTGAAAAAAGGGATCCTAAAGAGCATCCAGAACTTGAAGAGGTAGGAAAGCACATTGCAAAAAAGTGCAAAGGTCTGCCCTTAGCACTAAAGACGCTTGCTGGTTTGTTACGGTCCAAATCAGAGGTTGAAGAGTGGAGACGCATTTTGAGAAGTGA


Protein sequences

Name Description Sequence
I2 I2 [Nicotiana tabacum].

TRGPPTSLFDESDIFGRQTEIETLVDRLLSVDADGKKYRVIPIVGMAGVGKTTLAKAVYNNEKLKDRFDLKAWICVSEPYDASRITKGLLEEIGSSNLMVDNTLNQLQIKLKESLKGKKFLIVLDDVWNDKYIEWDDLRNPFAPGEIGSKIIVTTRKESVAEMMGSRPIIMEILSSEFSWPLFKRLAFEKRDPKEHPELEEVGKHIAKKCKGLPLALKTLAGLLRSKSEVEEWRRILRS

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-239 SSF52540

RGPPTSLFDESDIFGRQTEIETLVDRLLSVDADGKKYRVIPIVGMAGVGKTTLAKAVYNNEKLKDRFDLKAWICVSEPYDASRITKGLLEEIGSSNLMVDNTLNQLQIKLKESLKGKKFLIVLDDVWNDKYIEWDDLRNPFAPGEIGSKIIVTTRKESVAEMMGSRPIIMEILSSEFSWPLFKRLAFEKRDPKEHPELEEVGKHIAKKCKGLPLALKTLAGLLRSKSEVEEWRRILRS

Gene3D: G3DSA:3.40.50.300
11-128 G3DSA:3.40.50.300

ESDIFGRQTEIETLVDRLLSVDADGKKYRVIPIVGMAGVGKTTLAKAVYNNEKLKDRFDLKAWICVSEPYDASRITKGLLEEIGSSNLMVDNTLNQLQIKLKESLKGKKFLIVLDDVW

HMMPfam: PF00931
IPR002182
17-238 NB-ARC,NBS
NB-ARC

RQTEIETLVDRLLSVDADGKKYRVIPIVGMAGVGKTTLAKAVYNNEKLKDRFDLKAWICVSEPYDASRITKGLLEEIGSSNLMVDNTLNQLQIKLKESLKGKKFLIVLDDVWNDKYIEWDDLRNPFAPGEIGSKIIVTTRKESVAEMMGSRPIIMEILSSEFSWPLFKRLAFEKRDPKEHPELEEVGKHIAKKCKGLPLALKTLAGLLRSKSEVEEWRRILR

HMMPanther: PTHR11017
39-239 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RVIPIVGMAGVGKTTLAKAVYNNEKLKDRFDLKAWICVSEPYDASRITKGLLEEIGSSNLMVDNTLNQLQIKLKESLKGKKFLIVLDDVWNDKYIEWDDLRNPFAPGEIGSKIIVTTRKESVAEMMGSRPIIMEILSSEFSWPLFKRLAFEKRDPKEHPELEEVGKHIAKKCKGLPLALKTLAGLLRSKSEVEEWRRILRS

HMMPanther: PTHR11017:SF20
39-239 PTHR11017:SF20,SUBFAMILY NOT NAMED

RVIPIVGMAGVGKTTLAKAVYNNEKLKDRFDLKAWICVSEPYDASRITKGLLEEIGSSNLMVDNTLNQLQIKLKESLKGKKFLIVLDDVWNDKYIEWDDLRNPFAPGEIGSKIIVTTRKESVAEMMGSRPIIMEILSSEFSWPLFKRLAFEKRDPKEHPELEEVGKHIAKKCKGLPLALKTLAGLLRSKSEVEEWRRILRS

FPrintScan: PR00364
IPR000767
40-55 DISEASERSIST
Disease resistance protein

VIPIVGMAGVGKTTLA

FPrintScan: PR00364
IPR000767
114-128 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
210-224 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGLL


List of References

Brett C Couch, Russ Spangler, Christine Ramos, Georgiana May
Pervasive purifying selection characterizes the evolution of I2 homologs.
Mol. Plant Microbe Interact.: 2006, 19(3);288-303
PubMed:16570659 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox