PRGDB00049298 (I2)

From PRG Wiki
Jump to: navigation, search
I2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77641454 (DQ206210)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum clone 3133 I2 (I2) gene, partial cds.

DNA Sequence

ACTAGAAGACCTTCAACTTCTGTGGTTGATGAGTCTGATATGTTTGGTAGGCAGAATGAAGAACAAGAATTGGTTAGTCGCTTATTGTCTGTTGATGCAAATGGAAAAAGACTGACTGCAATTTCAATTGTTGGAATGGCTGGAATTGGCAAGACAATGCTTGCTAAAGCTGTTTACAATGATGAGAAGGTGGAAGACTATTTTGGTTTGAAAGCTTGGTTTTGTGTGTCTGAACCATATGATACGCTCAGAATAACGAAAGGGTTACTTCAAGAGACAGGCTCATTTGACTTAAAGTTAGATAACAATCTTAAGGTCAAATTGAAGGAAATCTTAAAGGGAAAAAGGTTTCTTATTGTCCTAGATGATATGTGGAATGATAACTATAATGAGTGGGATGACTTGAGAAATCTTTTTGTAAAAGGAGATGTCGGAAGTAAGATCATTGTGACAACACGTAAGGAAAGTGTTGCCTTGATGATGGGGAAGGATAAAATTAGCATGGGCATTTTGTCTAGTGAAGATTCTTGGTCTTTATTCAAAAGACATGCATTTGAATACATGGATCCCCAGGAGCAACAAGAACTTAAAGAGGTTGGAAAACAAATTGTAGCTAAGTGCAAAGGTCTCCCTTTAGCTCTGAAGACACTCGCTGGCATGTTAAGCTCCAAATCAGAGGTTGAAG


Protein sequences

Name Description Sequence
I2 I2 [Nicotiana tabacum].

TRRPSTSVVDESDMFGRQNEEQELVSRLLSVDANGKRLTAISIVGMAGIGKTMLAKAVYNDEKVEDYFGLKAWFCVSEPYDTLRITKGLLQETGSFDLKLDNNLKVKLKEILKGKRFLIVLDDMWNDNYNEWDDLRNLFVKGDVGSKIIVTTRKESVALMMGKDKISMGILSSEDSWSLFKRHAFEYMDPQEQQELKEVGKQIVAKCKGLPLALKTLAGMLSSKSEVE

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-223 SSF52540

RRPSTSVVDESDMFGRQNEEQELVSRLLSVDANGKRLTAISIVGMAGIGKTMLAKAVYNDEKVEDYFGLKAWFCVSEPYDTLRITKGLLQETGSFDLKLDNNLKVKLKEILKGKRFLIVLDDMWNDNYNEWDDLRNLFVKGDVGSKIIVTTRKESVALMMGKDKISMGILSSEDSWSLFKRHAFEYMDPQEQQELKEVGKQIVAKCKGLPLALKTLAGMLSS

Gene3D: G3DSA:3.40.50.300
9-129 G3DSA:3.40.50.300

VDESDMFGRQNEEQELVSRLLSVDANGKRLTAISIVGMAGIGKTMLAKAVYNDEKVEDYFGLKAWFCVSEPYDTLRITKGLLQETGSFDLKLDNNLKVKLKEILKGKRFLIVLDDMWNDNY

HMMPfam: PF00931
IPR002182
19-228 NB-ARC,NBS
NB-ARC

NEEQELVSRLLSVDANGKRLTAISIVGMAGIGKTMLAKAVYNDEKVEDYFGLKAWFCVSEPYDTLRITKGLLQETGSFDLKLDNNLKVKLKEILKGKRFLIVLDDMWNDNYNEWDDLRNLFVKGDVGSKIIVTTRKESVALMMGKDKISMGILSSEDSWSLFKRHAFEYMDPQEQQELKEVGKQIVAKCKGLPLALKTLAGMLSSKSEVE

FPrintScan: PR00364
IPR000767
40-55 DISEASERSIST
Disease resistance protein

AISIVGMAGIGKTMLA

HMMPanther: PTHR11017:SF20
41-228 PTHR11017:SF20,SUBFAMILY NOT NAMED

ISIVGMAGIGKTMLAKAVYNDEKVEDYFGLKAWFCVSEPYDTLRITKGLLQETGSFDLKLDNNLKVKLKEILKGKRFLIVLDDMWNDNYNEWDDLRNLFVKGDVGSKIIVTTRKESVALMMGKDKISMGILSSEDSWSLFKRHAFEYMDPQEQQELKEVGKQIVAKCKGLPLALKTLAGMLSSKSEVE

HMMPanther: PTHR11017
41-228 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISIVGMAGIGKTMLAKAVYNDEKVEDYFGLKAWFCVSEPYDTLRITKGLLQETGSFDLKLDNNLKVKLKEILKGKRFLIVLDDMWNDNYNEWDDLRNLFVKGDVGSKIIVTTRKESVALMMGKDKISMGILSSEDSWSLFKRHAFEYMDPQEQQELKEVGKQIVAKCKGLPLALKTLAGMLSSKSEVE

FPrintScan: PR00364
IPR000767
111-125 DISEASERSIST
Disease resistance protein

ILKGKRFLIVLDDMW

FPrintScan: PR00364
IPR000767
207-221 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox