PRGDB00049301 (I2)

From PRG Wiki
Jump to: navigation, search
I2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77641448 (DQ206207)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum clone 1844 I2 (I2) gene, partial cds.

DNA Sequence

TTTCAACTTCTGTGGTTGATGAATCTGACATCTTTGGTAGGCAGAATGAAATAAATATATTGGTTGACCGTTTATTGTCTGATGATGCAAAAGAAAAAAAGTTGACTGTAATTCCTATTATTGGAATGGCGGGTGTTGGCAAGACAACACTTGCTAAAGTTGTTTACAATGGTGAGAAGGTGAAACAACATTTTAAGTTGAAATCTTGGATCTGTGTGTCTGAACCATATGATGTTTTTAGAATAACAAAAGGGTTACTTCAAGAAATTGGTTCATCCGACTTGATGGTTGACAACAATCTTAATCAGCTTCAGATCAAATTGATGGAAAGCTTAAAGGGGAAAAAGTTCCTTATTGTTTTAGATGATGTTTGGAATGACAACTACAATGATTGGTATGACTTGAGAAATCCTTTTGCACAAGGAGAAAATGGAAGTATGATCATTGTGACGACACGTAAGGAGAGTGTTGCCTTGATGATGGGTAGTGGGCTAATTAACGTGGGAACTCTGTCTACTGAAGTCTCTTGGCCTTTATTCAAAAGACATGCATTTGAAAATAGGGATCCTAAGGAAAATCCAGAACTTGAAGAGATAGGAAAACAAATTGCAATTAAGTGCAAAGGATTGCCTTTAGCACTAAA


Protein sequences

Name Description Sequence
I2 I2 [Nicotiana tabacum].

STSVVDESDIFGRQNEINILVDRLLSDDAKEKKLTVIPIIGMAGVGKTTLAKVVYNGEKVKQHFKLKSWICVSEPYDVFRITKGLLQEIGSSDLMVDNNLNQLQIKLMESLKGKKFLIVLDDVWNDNYNDWYDLRNPFAQGENGSMIIVTTRKESVALMMGSGLINVGTLSTEVSWPLFKRHAFENRDPKENPELEEIGKQIAIKCKGLPLAL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
3-213 SSF52540

SVVDESDIFGRQNEINILVDRLLSDDAKEKKLTVIPIIGMAGVGKTTLAKVVYNGEKVKQHFKLKSWICVSEPYDVFRITKGLLQEIGSSDLMVDNNLNQLQIKLMESLKGKKFLIVLDDVWNDNYNDWYDLRNPFAQGENGSMIIVTTRKESVALMMGSGLINVGTLSTEVSWPLFKRHAFENRDPKENPELEEIGKQIAIKCKGLPLAL

HMMPanther: PTHR11017
4-213 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VVDESDIFGRQNEINILVDRLLSDDAKEKKLTVIPIIGMAGVGKTTLAKVVYNGEKVKQHFKLKSWICVSEPYDVFRITKGLLQEIGSSDLMVDNNLNQLQIKLMESLKGKKFLIVLDDVWNDNYNDWYDLRNPFAQGENGSMIIVTTRKESVALMMGSGLINVGTLSTEVSWPLFKRHAFENRDPKENPELEEIGKQIAIKCKGLPLAL

HMMPanther: PTHR11017:SF20
4-213 PTHR11017:SF20,SUBFAMILY NOT NAMED

VVDESDIFGRQNEINILVDRLLSDDAKEKKLTVIPIIGMAGVGKTTLAKVVYNGEKVKQHFKLKSWICVSEPYDVFRITKGLLQEIGSSDLMVDNNLNQLQIKLMESLKGKKFLIVLDDVWNDNYNDWYDLRNPFAQGENGSMIIVTTRKESVALMMGSGLINVGTLSTEVSWPLFKRHAFENRDPKENPELEEIGKQIAIKCKGLPLAL

Gene3D: G3DSA:3.40.50.300
5-150 G3DSA:3.40.50.300

VDESDIFGRQNEINILVDRLLSDDAKEKKLTVIPIIGMAGVGKTTLAKVVYNGEKVKQHFKLKSWICVSEPYDVFRITKGLLQEIGSSDLMVDNNLNQLQIKLMESLKGKKFLIVLDDVWNDNYNDWYDLRNPFAQGENGSMIIVT

HMMPfam: PF00931
IPR002182
13-213 NB-ARC,NBS
NB-ARC

RQNEINILVDRLLSDDAKEKKLTVIPIIGMAGVGKTTLAKVVYNGEKVKQHFKLKSWICVSEPYDVFRITKGLLQEIGSSDLMVDNNLNQLQIKLMESLKGKKFLIVLDDVWNDNYNDWYDLRNPFAQGENGSMIIVTTRKESVALMMGSGLINVGTLSTEVSWPLFKRHAFENRDPKENPELEEIGKQIAIKCKGLPLAL

FPrintScan: PR00364
IPR000767
36-51 DISEASERSIST
Disease resistance protein

VIPIIGMAGVGKTTLA

FPrintScan: PR00364
IPR000767
110-124 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
206-213 DISEASERSIST
Disease resistance protein

CKGLPLAL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox