PRGDB00049304 (I2)

From PRG Wiki
Jump to: navigation, search
I2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 77641442 (DQ206204)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum clone 3160 I2 (I2) gene, partial cds.

DNA Sequence

ATAAGGGAATCTTCAACTTCTGTTGTTGATGAATCTGATATCTTAGGTAGGCAGAACGAAATAGAGGGATTGATTGACCGTTTGTTGTCTGAGGATGGAAGGAATCTGACTGTAGTTCCTGTTGTTGGAATGGGGGGCGTGGGCAAGACAACACTTGCTAAAGCTGTTTACAATGATGAGAAAGTAAAAAACCATTTTGGTTTCAAAGCTTGGATCTGTGTGTCTGAACCATATGATATTCTCAGAATAACAAAGGAGTTACTTCAAGAATTTGGCTTAACGGTTGATAACAATCTGAATCAACTTCAAATCAAATTGAAGGAAAGCTTAAAGGGAAAAAAGTTTCTTATTGTCCTAGATGATGTGTGGAATGAAAACTATAAAGAGTGGAATGGCTTGAGAAATCTTTTTGTACAAGGAGATGTAGGAAGTAAGATCATTGTGACGACACGTAAGGAGAGTGTTGCCTTGATGATGGGTTATGGAGCAATCAATGTGGGGACTCTGTCTAGTGAAGTTTCTTGGGATCTATTCAAGCGACATTCATTTGAAAATAGGGATCCTGAGGAACATCCAGAACTTGAAGAGATTGGAATACAAATTGCACACAAGTGCAAAGGTTTGCCTTTAGCTCTAAAGGCACTTGCTGGTATTTTACGCTCCAAATCAGAGGTGGATGAGTGGAGAGACATTTTAAG


Protein sequences

Name Description Sequence
I2 I2 [Nicotiana tabacum].

IRESSTSVVDESDILGRQNEIEGLIDRLLSEDGRNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGFKAWICVSEPYDILRITKELLQEFGLTVDNNLNQLQIKLKESLKGKKFLIVLDDVWNENYKEWNGLRNLFVQGDVGSKIIVTTRKESVALMMGYGAINVGTLSSEVSWDLFKRHSFENRDPEEHPELEEIGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDIL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-231 SSF52540

RESSTSVVDESDILGRQNEIEGLIDRLLSEDGRNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGFKAWICVSEPYDILRITKELLQEFGLTVDNNLNQLQIKLKESLKGKKFLIVLDDVWNENYKEWNGLRNLFVQGDVGSKIIVTTRKESVALMMGYGAINVGTLSSEVSWDLFKRHSFENRDPEEHPELEEIGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDI

HMMPfam: PF00931
IPR002182
17-232 NB-ARC,NBS
NB-ARC

RQNEIEGLIDRLLSEDGRNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGFKAWICVSEPYDILRITKELLQEFGLTVDNNLNQLQIKLKESLKGKKFLIVLDDVWNENYKEWNGLRNLFVQGDVGSKIIVTTRKESVALMMGYGAINVGTLSSEVSWDLFKRHSFENRDPEEHPELEEIGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDIL

Gene3D: G3DSA:3.40.50.300
19-154 G3DSA:3.40.50.300

NEIEGLIDRLLSEDGRNLTVVPVVGMGGVGKTTLAKAVYNDEKVKNHFGFKAWICVSEPYDILRITKELLQEFGLTVDNNLNQLQIKLKESLKGKKFLIVLDDVWNENYKEWNGLRNLFVQGDVGSKIIVTTRKES

FPrintScan: PR00364
IPR000767
38-53 DISEASERSIST
Disease resistance protein

VVPVVGMGGVGKTTLA

HMMPanther: PTHR11017
38-232 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VVPVVGMGGVGKTTLAKAVYNDEKVKNHFGFKAWICVSEPYDILRITKELLQEFGLTVDNNLNQLQIKLKESLKGKKFLIVLDDVWNENYKEWNGLRNLFVQGDVGSKIIVTTRKESVALMMGYGAINVGTLSSEVSWDLFKRHSFENRDPEEHPELEEIGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDIL

HMMPanther: PTHR11017:SF20
38-232 PTHR11017:SF20,SUBFAMILY NOT NAMED

VVPVVGMGGVGKTTLAKAVYNDEKVKNHFGFKAWICVSEPYDILRITKELLQEFGLTVDNNLNQLQIKLKESLKGKKFLIVLDDVWNENYKEWNGLRNLFVQGDVGSKIIVTTRKESVALMMGYGAINVGTLSSEVSWDLFKRHSFENRDPEEHPELEEIGIQIAHKCKGLPLALKALAGILRSKSEVDEWRDIL

FPrintScan: PR00364
IPR000767
109-123 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
205-219 DISEASERSIST
Disease resistance protein

CKGLPLALKALAGIL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox