PRGDB00049496 (Pikh)

From PRG Wiki
Jump to: navigation, search
Pikh
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 63103205 (AY914077)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) cultivar Tetep NBS-LRR (Pikh) gene, partial cds.

DNA Sequence

ATGTCAGAGCTTCAATCACTGCCAGACCTCAATAGACTATCACTAGTGAACCTTGAAAAGGTTTCAGACACTGAAGATGCAAGAATGGCAAAACTTCAAGAGAAAGAAAAGCTCGAGACATTGATGTTGAGGTGGAATATGGATGCTGGAAATGCCAGTAGAATAGATCATGAAGTACTTGAAACCCTCCAACCTAGCCAGTGCCTGAAAACTTTGGAGATTGTTGCGTATGAAGGATATGTATTTCCATCTTGGATGACAAGAACCGAGCCATATCTTACATCTCTGGTTGAGATAAGACTAGTTAATATGAGAGCATGTGAAAAGGCATTACCTCCACTTGGGATACTACCATGTCTGAAGATTGCAGAGATAAGTGGAGTTGATAATCTCAGTTCTATTGGTGATAATTTCTATGGTCATAACGGCACATTCCCTTCACTGGAGAAGCTGATTCTATCATACATGACAAGCCTTGAAGTCTGGGAACAGTCATCTAGGATGAATCTGTTTCCTCGTCTTGCAGAACTTGTCATCATTCAGTGCCCAAAATTGAGAGCACTGCATATGGAGTTTCCATCGATTGAAAAGTTGATTTTGTGGATGAATAACAAGATGTTGTACAGCTCGAAGGAAGGTATGAGAGGTGTAGAGAAGAGCCTCGAAAATCTTTCAATTTCTTTCTGTGAAGAGTTGCATGCTTCTTCAGGCTGTGAGGGTCTACAGGCTCTTGATCGCCTCAAGAAGTTGGAGATATGTGGTTGTCATGAATTATCATGCCTCCCACAGGGTTTGCAGCATCTTTCCTCTCTCACCAGCTTGAAAATTGATAACTGCAACAAATTGGAGATTTTGCCAGAATGGTTGGAGAACCTACCTTTTCTACAGATAATGTGTTTGTCTGGCTGTCCAATTCTGCACTCCATTCCTGAAGGCCTAACATGTAGCGACATTATTGTTGAAGATTGCCCCAATTTTAAAGAACCATCAG


Protein sequences

Name Description Sequence
NBS-LRR NBS-LRR [Oryza sativa (indica cultivar-group)].

MSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPSQCLKTLEIVAYEGYVFPSWMTRTEPYLTSLVEIRLVNMRACEKALPPLGILPCLKIAEISGVDNLSSIGDNFYGHNGTFPSLEKLILSYMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGMRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIPEGLTCSDIIVEDCPNFKEPS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-309 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPSQCLKTLEIVAYEGYVFPSWMTRTEPYLTSLVEIRLVNMRACEKALPPLGILPCLKIAEISGVDNLSSIGDNFYGHNGTFPSLEKLILSYMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGMRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSI

HMMPanther: PTHR23155:SF216
1-309 PTHR23155:SF216,OS11G0640600 PROTEIN

MSELQSLPDLNRLSLVNLEKVSDTEDARMAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPSQCLKTLEIVAYEGYVFPSWMTRTEPYLTSLVEIRLVNMRACEKALPPLGILPCLKIAEISGVDNLSSIGDNFYGHNGTFPSLEKLILSYMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGMRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSI

superfamily: SSF52047
68-310 SSF52047,LRR

CLKTLEIVAYEGYVFPSWMTRTEPYLTSLVEIRLVNMRACEKALPPLGILPCLKIAEISGVDNLSSIGDNFYGHNGTFPSLEKLILSYMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGMRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPILHSIP

Gene3D: G3DSA:3.80.10.10
91-306 G3DSA:3.80.10.10

PYLTSLVEIRLVNMRACEKALPPLGILPCLKIAEISGVDNLSSIGDNFYGHNGTFPSLEKLILSYMTSLEVWEQSSRMNLFPRLAELVIIQCPKLRALHMEFPSIEKLILWMNNKMLYSSKEGMRGVEKSLENLSISFCEELHASSGCEGLQALDRLKKLEICGCHELSCLPQGLQHLSSLTSLKIDNCNKLEILPEWLENLPFLQIMCLSGCPIL


List of References

T R Sharma, M S Madhav, B K Singh, P Shanker, T K Jana, V Dalal, A Pandit, A Singh, K Gaikwad, H C Upreti, N K Singh
High-resolution mapping, cloning and molecular characterization of the Pi-k ( h ) gene of rice, which confers resistance to Magnaporthe grisea.
Mol. Genet. Genomics: 2005, 274(6);569-78
PubMed:16228246 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox