PRGDB00049498 (putative Pto-like serine/threonine kinase)

From PRG Wiki
Jump to: navigation, search
putative Pto-like serine/threonine kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 51093213 (AY693369)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Mangifera indica

Comment?

Mangifera indica putative Pto-like serine/threonine kinase gene, partial cds.

DNA Sequence

TTTTGGGGGGGTGTACCGGGGTCTAGGCAGGGCCTTCCAGAATTCCAGACCGAGATAACCGTTTTATCCAAGATTCGACACCGTCATCTTGTTTCACTTGTTGGGTATTGTGAAGAACAGTCAGAAATGATACTGGTTTATGAGTACATGGAGAAAGGGCCTCTCAAGAGCCATTTGTATGGGTCAAAACATCCTCCTTTGTCGTGGAAGCAAAGGCTTGAAATATGCATTGGCTCTGCAAGAGGTCTCCACTATCTTCATACTGGTTCAGCACAAGGAATCATCCATCGTGACATCAAATCCACCAATATTTTGCTTGATGAAAATTATGTGGCTAAGGTTGCTGATTTTGGTCTTTCAAGATCTGGTCCATGTCTTGATGAGACACATGTAAGCACTGGCGTAAAAGGTAGTTTTGGATATCTTGATCCTGAGTACTTTCGAAGACAGCAGCTTACAGATAAGTCAGACGTCTACTCCTTCGGCATA


Protein sequences

Name Description Sequence
putative Pto-like serine/threonine kinase putative Pto-like serine/threonine kinase [Mangifera indica].

FWGGVPGSRQGLPEFQTEITVLSKIRHRHLVSLVGYCEEQSEMILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-163 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FWGGVPGSRQGLPEFQTEITVLSKIRHRHLVSLVGYCEEQSEMILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

HMMPanther: PTHR24420
4-163 PTHR24420,FAMILY NOT NAMED

GVPGSRQGLPEFQTEITVLSKIRHRHLVSLVGYCEEQSEMILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

HMMPanther: PTHR24420:SF550
4-163 PTHR24420:SF550

GVPGSRQGLPEFQTEITVLSKIRHRHLVSLVGYCEEQSEMILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

superfamily: SSF56112
IPR011009
8-163 Kinase_like
Protein kinase-like domain

SRQGLPEFQTEITVLSKIRHRHLVSLVGYCEEQSEMILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

Gene3D: G3DSA:3.30.200.20
8-42 G3DSA:3.30.200.20

SRQGLPEFQTEITVLSKIRHRHLVSLVGYCEEQSE

HMMPfam: PF07714
IPR001245
13-163 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

PEFQTEITVLSKIRHRHLVSLVGYCEEQSEMILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

Gene3D: G3DSA:1.10.510.10
43-163 G3DSA:1.10.510.10

MILVYEYMEKGPLKSHLYGSKHPPLSWKQRLEICIGSARGLHYLHTGSAQGIIHRDIKSTNILLDENYVAKVADFGLSRSGPCLDETHVSTGVKGSFGYLDPEYFRRQQLTDKSDVYSFGI

PatternScan: PS00108
IPR008271
94-106 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox