PRGDB00049499 (RGC2S)

From PRG Wiki
Jump to: navigation, search
RGC2S
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4106973 (AF113957)
Gene Class NL
Domain Type NBS, LRR, LRR, Others
Gene Species Lactuca sativa

Comment?

Lactuca sativa resistance protein candidate RGC2S (RGC2S) gene, complete cds.

DNA Sequence

ATGTCGGACCCAACGGGGATTGCTGGTGCCATTATTAACCCAATTGCTCAGAGGGCCTTGGTTCCCGTTACAGACCATGTAGGCTACATGATTTCCTGCAGAAAATATGTGAGGGTCATGCAGACGAAAATGACAGAGTTGAATACCTCAAGAATCAGTGTAGAGGAACACATTAGCCGGAACACAAGAAATCATCTTCAGATTCCATCTCAAATTAAGGATTGGTTGGACCAAGTAGAAGGGATCAGAGCAAATGTGGAAAACTTTCCGATTGATGTCATCACTTGTTGTAGTCTCAGGATCAGGCACAAGCTTGGACAGAAAGCCTTCAAGATAACTGAGCAGATTGAAAGTCTAACAAGACAGCTCTCCCTGATCAGTTGGACTGATGATCCAGTTCCTCTAGGAAGAGTTGGTTCCATGAATGCATCCACCTCTGCATCATCAAGTGATGATTTCCCATCAAGAGAGAAAACTTTTACACAAGCACTAAAAGCACTCGAACCCAACCAACAATTCCACATGGTAGCCTTGTGTGGGATGGGTGGAGTAGGGAAGACTAGAATGATGCAAAGGCTGAAGAAGGCCGCTGAAGAAAAGAAATTGTTTAATTATATTGTTAGGGCAGTTATAGGGGAAAAGACGGACCCCTTTGCCATTCAAGAAGCTATAGCAGATTACCTCGGTATACAACTCAATGAAAAAACTAAGCCAGCAAGAGCTGATAAGCTTCGTGAATGGTTCAAAAAGAATTCAGATGGAGGTAAGACTAAGTTCCTCATAGTACTTGACGATGTTTGGCAATTAGTTGATCTTGAAGATATTGGGTTAAGTCCTTTTCCAAATCAAGGTGTCGACTTCAAGGTCTTGTTGACATCACGAGACTCACAAGTTTGCACTATGATGGGGGTTGAAGCTAATTCAATTATTAACGTGGGCCTTCTAACTGAAGCAGAAGCTCAAAGTCTGTTCCAGCAATTTGTAGAAACTTCTGAGCCCGAGCTCCAGAAGATAGGAGAGGATATCGTAAGGAAGTGTTGCGGTCTACCTATTGCCATAAAAACCATGGCATGTACTCTTAGAAATAAAAGAAAGGATGCATGGAAGGATGCACTTTCGCGCATAGAGCACTATGACATTCACAATGTTGCGCCCAAAGTCTTTGAAACGAGCTACCACAATCTCCAAGAAGAGGAGACTAAATCCACTTTTTTAATGTGTGGTTTGTTTCCCGAAGACTTCGATATTCCTACTGAGGAGTTGATGAGGTATGGATGGGGCTTGAAGCTATTTGATAGAGTTTATACGATTAGAGAAGCAAGAACCAGGCTCAACACCTGCATTGAGCGACTGGTGCAGACAAATTTGTTAATTGAAAGTGATGATGTTGGGTGTGTCAAGATGCATGATCTGGTCCGTGCTTTTGTTTTGGGTATGTTTTCTGAAGTCGAGCATGCTTCTATTGTCAACCATGGTAATATGCCCGAGTGGACTGAAAATGATATAACTGACTCTTGCAAAAGAATTTCATTAACATGCAAGAGTATGTCTAAGTTTCCAGGAGATTTCAAGTTTCCAAACCTAATGATTTTGAAACTTATGCATGGAGATAAGTCGCTAAGGTTTCCTCAAGACTTTTATGAAGGAATGGAAAAGCTCCATGTTATATCATACGATAAAATGAAGTACCCATTGCTTCCTTTGGCACCTCGATGCTCCACCAACATTCGGGTGCTTCATCTCACTAAATGTTCATTAAAGATGTTTGATTGCTCTTGTATTGGAAATCTATCGAATCTGGAAGTGCTGAGCTTTGCTAATTCTCGCATTGAATGGTTACCTTCCACAGTCAGAAATTTAAAGAAGCTAAGGTTACTTGATCTGAGATTTTGTGATGGTCTCCGTATAGAACAGGGTGTCTTGAAAAGTTTAGTCAAACTTGAAGAATTTTATATTGGAAATGCATCTGGGTTTATAGATGATAACTGCAATGAGATGGCAGAGCGTTCTGACAACCTTTCTGCATTAGAATTCGCGTTCTTTAATAACAAGGCTGAAGTGAAAAATATGTCATTTGAGAATCTTGAACGATTCAAGATCTCAGTGGGACGCTCTTTTGATGGAAATATCAATATGAGTAGCCACTCATACGAAAACATGTTGCAATTGGTGACCAACAAAGGTGATGTATTAGACTCTAAACTTAATGGGTTATTTTTGAAAACAAAGGTGCTTTTTTTAAGTGTGCATGGCATGAATGATCTTGAAGATGTTGAGGTGAAGTCGACACATCCTACTCAGTCCTCTTCATTCTGCAATTTAAAAGTTCTTATTATTTCAAAGTGTGTAGAGTTGAGATACCTTTTCAAACTCAATCTTGCAAACACTTTGTCAAGACTTGAGCATCTAGAAGTTTGTGAATGCGAGAATATGGAAGAACTCATACATACTGGAATTTGTGGAGAAGAGACAATTACTTTCCCTAAGCTGAAGTTTTTATCTTTGAGTCAACTACCGAAGTTATCAAGTTTGTGCCATAATGTCAACATAATTGGGCTACCACATCTCGTAGACTTGATACTTAAGGGCATTCCAGGTTTCACAGTCATTTATCCGCAGAACAAGTTGCGAACATCTAGTTTGTTGAAGGAAGAGGTTGTGATTCCTAAGTTGGAGACACTTCAAATTGATGACATGGAGAACTTAGAAGAAATATGGCCTTGTGAACTTAGTGGAGGTGAGAAAGTTAAGTTGAGAGAGATTAAAGTGAGTAGCTGTGATAAGCTTGTGAATCTATTTCCGCGCAATCCCATGTCTCTGTTGCATCATCTTGAAGAGCTTAAAGTCAAGAATTGCGGTTCCATTGAATCGTTATTCAACATTGACTTGGATTGTGTCGGTGCAATTGGAGAAGAAGACAACAAGAGCCTCTTAAGAAGCATCAACATGGAGAATTTAGGGAAGCTAAGAGAGGTGTGGAGGATAAAAGGTGCAGATAACTCTCATCTCATCAACGGTTTTCAAGCTGTTGAAAGCATAAAGATTGAAAAATGTAAGAGGTTTAGCAATATATTCACACCTATCACCGCCAATTTTTATCTGGTGGCACTTTTGGAGATTCAGATAGAAGGTTGCGGAGGAAATCACGAATCAGAAGAGCAGATTGAAATTCTATCAGAGAAAGAGACATTACAAGAAGTCACTGATACTAATATTTCTAATGATGTTGTATTATTCCCATCCTGTCTCATGCACTCTTTTCATAACCTCCATAAACTTAAATTGGAGAGAGTTAAAGGAGTGGAGGTGGTGTTTGAGATAGAGAGTGAGAGTCCAACAAGTAGAGAATTGGTAACAACTCACCATAACCAACAACATCCTATTATACTTCCCAACCTCCAGGAATTGGATCTAAGTTTTATGGACAACATGAGTCATGTGTGGAAGTGCAGCAACTGGAATAAATTCTTCACTCTTCCAAAACAACAATCAGAATCCCCATTCCACAACCTCACAACCATACACATGTTCAGCTGCAGAAGCATTAAGTACTTGTTTTCGCCTCTCATGGCAGAACTTCTTTCCAACCTAAAGGATATCTGGATAAGTGGGTGTAATGGTATTAAAGAAGTTGTTTCAAAGAGAGATGATGAGGATGAAGAAATGACTACATTTACATCTACCCACACAACCACCATCTTGTTCCCTCATCTTGATTCTCTCACTCTAAGACTACTGGAGAATCTGAAGTGTATTGGTGGAGGTGGTGCCAAGGATGAGGGGAGCAATGAAATATCTTTCAATAATACCACTGCAACTACTGCTGTTCTTGATCAATTTGAGTTGTCTGAAGCAGGTGGTGTTTCTTGGAGTTTATGCCAATACGCTAGAGAGATAGAGATATCTAAGTGTAATGTATTGTCAAGTGTGATTCCATGTTATGCAGCAGGACAAATGCAAAAGCTTCAAGTGCTGAGAGTAACGGGTTGTGATGGCATGAAGGAGGTATTTGAAACTCAATTAGGGACGAGCAGCAACAAAAACAGAAAGGGTGGTGGTGATGAAGGAAATGGTGGAATTCCAAGAGTAAATAACAATGTTATTATGCTTCCCAATCTAAAGACATTGAAAATCTACATGTGCGGGGGTTTGGAACATATATTCACATTCTCTGCACTTGAAAGCCTGACACAGCTCCAAGAGTTAAAGATAGTGGGTTGCTACGGAATGAAAGTGATTGTGAAGAAGGAAGAAGATGAATATGGAGAGCAGCAAACAACAACAACAACAACAACGAAGGGGGCATCTTCTTCTTCTTCTTCTTCTTCTTCTAAGAAGGTTGTGGTCTTTCCCCGTCTAAAGTCCATTGAACTATTCAATCTACCAGAGCTGGTAGGATTCTTCTTGGGGATGAATGAGTTCCGGTTGCCTTCATTGGAAGAAGTTACCATCAAGTATTGCTCAAAAATGATGGTGTTTGCAGCTGGTGGGTCCACAGCTCCCCAACTCAAGTATATACACACAAGATTAGGCAAACATACTCTTGATCAAGAATCTGGCCTTAACTTTCATCAGACCTCATTCCAAAGTTTATACGGTGACACCTCGGGCCCTGCTACTTCAGAAGGGACAACTTGGTCTTTTCATAACTTGATCGAATTAGATATGGAATTAAATTATGATGTTAAAAAGATTATTCCATCCAGTGAGTTGCTGCAACTGCAAAAGCTGGAAAAGATTCATGTGAGTAGTTGTTATTGGGTAGAGGAGGTATTTGAAACTGCATTGGAAGCAGCAGGGAGAAATGGAAATAGTGGAATTGGTTTTGATGAATCGTCACAAACTACTACTACTACTACTCTTTTCAATCTTCGAAACCTCAGAGAAATGAAGTTGCATTTTCTACGTGGTCTGAGGTATATATGGAAGAGCAATCAGTGGACAGCATTTGAGTTTCCAAACCTAACAAGAGTTCATATAAGTAGGTGTAGAAGGTTAGAACATGTATTTACTAGTTCCATGGTTGGTAGTCTATTGCAACTCCAAGAGCTAGATATTAGTTGGTGCAACCATATGGAGGAGGTGATTGTTAAGGATGCAGATGTTTCTGTTGAAGAAGACAAAGAGAGAGAATCTGATGGCAAGACGAATAAGGAGATACTTGTGTTACCTCGTCTAAAATCCTTGAAATTAAAATGCCTTCCATGTCTTAAGGGGTTTAGCTTGGGGAAGGAGGATTTTTCATTCCCATTATTGGATACTTTAGAAATCTACAAATGCCCAGCAATAACGACCTTCACCAAGGGAAATTCTGCTACTCCACAGCTAAAAGAAATAGAAACAAGATTTGGCTCGTTTTATGCAGGGGAAGACATCAACTCCTCTATTATAAAAAGATCAAACAACAGGAGTTCAAACAAAACTCTGATTAATGTGAAGTGA


Protein sequences

Name Description Sequence
resistance protein candidate RGC2S resistance protein candidate RGC2S [Lactuca sativa].

MSDPTGIAGAIINPIAQRALVPVTDHVGYMISCRKYVRVMQTKMTELNTSRISVEEHISRNTRNHLQIPSQIKDWLDQVEGIRANVENFPIDVITCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGSMNASTSASSSDDFPSREKTFTQALKALEPNQQFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVRAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEELMRYGWGLKLFDRVYTIREARTRLNTCIERLVQTNLLIESDDVGCVKMHDLVRAFVLGMFSEVEHASIVNHGNMPEWTENDITDSCKRISLTCKSMSKFPGDFKFPNLMILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTKCSLKMFDCSCIGNLSNLEVLSFANSRIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSLVKLEEFYIGNASGFIDDNCNEMAERSDNLSALEFAFFNNKAEVKNMSFENLERFKISVGRSFDGNINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTKVLFLSVHGMNDLEDVEVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGICGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEEVVIPKLETLQIDDMENLEEIWPCELSGGEKVKLREIKVSSCDKLVNLFPRNPMSLLHHLEELKVKNCGSIESLFNIDLDCVGAIGEEDNKSLLRSINMENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFSNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEVTDTNISNDVVLFPSCLMHSFHNLHKLKLERVKGVEVVFEIESESPTSRELVTTHHNQQHPIILPNLQELDLSFMDNMSHVWKCSNWNKFFTLPKQQSESPFHNLTTIHMFSCRSIKYLFSPLMAELLSNLKDIWISGCNGIKEVVSKRDDEDEEMTTFTSTHTTTILFPHLDSLTLRLLENLKCIGGGGAKDEGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEISKCNVLSSVIPCYAAGQMQKLQVLRVTGCDGMKEVFETQLGTSSNKNRKGGGDEGNGGIPRVNNNVIMLPNLKTLKIYMCGGLEHIFTFSALESLTQLQELKIVGCYGMKVIVKKEEDEYGEQQTTTTTTTKGASSSSSSSSSKKVVVFPRLKSIELFNLPELVGFFLGMNEFRLPSLEEVTIKYCSKMMVFAAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTSGPATSEGTTWSFHNLIELDMELNYDVKKIIPSSELLQLQKLEKIHVSSCYWVEEVFETALEAAGRNGNSGIGFDESSQTTTTTTLFNLRNLREMKLHFLRGLRYIWKSNQWTAFEFPNLTRVHISRCRRLEHVFTSSMVGSLLQLQELDISWCNHMEEVIVKDADVSVEEDKERESDGKTNKEILVLPRLKSLKLKCLPCLKGFSLGKEDFSFPLLDTLEIYKCPAITTFTKGNSATPQLKEIETRFGSFYAGEDINSSIIKRSNNRSSNKTLINVK

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
127-383 SSF52540

SWTDDPVPLGRVGSMNASTSASSSDDFPSREKTFTQALKALEPNQQFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVRAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNV

Gene3D: G3DSA:3.40.50.300
150-274 G3DSA:3.40.50.300

SDDFPSREKTFTQALKALEPNQQFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVRAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLED

HMMPfam: PF00931
IPR002182
157-424 NB-ARC,NBS
NB-ARC

EKTFTQALKALEPNQQFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVRAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIEHYDIHNVAPKVFETSYHNLQEEETKSTFLMCGLFPEDFDIPTEELMRY

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

MVALCGMGGVGKTRMM

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

DGGKTKFLIVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CCGLPIAIKTMACTL

superfamily: SSF52058
467-1124 SSF52058,LRR

KMHDLVRAFVLGMFSEVEHASIVNHGNMPEWTENDITDSCKRISLTCKSMSKFPGDFKFPNLMILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTKCSLKMFDCSCIGNLSNLEVLSFANSRIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSLVKLEEFYIGNASGFIDDNCNEMAERSDNLSALEFAFFNNKAEVKNMSFENLERFKISVGRSFDGNINMSSHSYENMLQLVTNKGDVLDSKLNGLFLKTKVLFLSVHGMNDLEDVEVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGICGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKGIPGFTVIYPQNKLRTSSLLKEEVVIPKLETLQIDDMENLEEIWPCELSGGEKVKLREIKVSSCDKLVNLFPRNPMSLLHHLEELKVKNCGSIESLFNIDLDCVGAIGEEDNKSLLRSINMENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFSNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEVTDTNISNDVVLFPSCLMHSFHNLHKLKLERVKGVEVVFEIESESPTSRELVTTHHNQ

Gene3D: G3DSA:3.80.10.10
504-655 G3DSA:3.80.10.10

DSCKRISLTCKSMSKFPGDFKFPNLMILKLMHGDKSLRFPQDFYEGMEKLHVISYDKMKYPLLPLAPRCSTNIRVLHLTKCSLKMFDCSCIGNLSNLEVLSFANSRIEWLPSTVRNLKKLRLLDLRFCDGLRIEQGVLKSLVKLEEFYIGNA

HMMPfam: PF13855
574-631 LRR_8,Leucine rich repeat

TNIRVLHLTKCSLKMFDCSCIGNLSNLEVLSFANSRIEWLPSTVRNLKKLRLLDLRFC

FPrintScan: PR00364
IPR000767
618-634 DISEASERSIST
Disease resistance protein

RNLKKLRLLDLRFCDGL

Gene3D: G3DSA:3.80.10.10
759-863 G3DSA:3.80.10.10

EVKSTHPTQSSSFCNLKVLIISKCVELRYLFKLNLANTLSRLEHLEVCECENMEELIHTGICGEETITFPKLKFLSLSQLPKLSSLCHNVNIIGLPHLVDLILKG

Gene3D: G3DSA:3.80.10.10
888-1019 G3DSA:3.80.10.10

IPKLETLQIDDMENLEEIWPCELSGGEKVKLREIKVSSCDKLVNLFPRNPMSLLHHLEELKVKNCGSIESLFNIDLDCVGAIGEEDNKSLLRSINMENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCK

superfamily: SSF52047
954-1212 SSF52047,LRR

SIESLFNIDLDCVGAIGEEDNKSLLRSINMENLGKLREVWRIKGADNSHLINGFQAVESIKIEKCKRFSNIFTPITANFYLVALLEIQIEGCGGNHESEEQIEILSEKETLQEVTDTNISNDVVLFPSCLMHSFHNLHKLKLERVKGVEVVFEIESESPTSRELVTTHHNQQHPIILPNLQELDLSFMDNMSHVWKCSNWNKFFTLPKQQSESPFHNLTTIHMFSCRSIKYLFSPLMAELLSNLKDIWISGCNGIKEVV

Gene3D: G3DSA:3.80.10.10
1150-1208 G3DSA:3.80.10.10

CSNWNKFFTLPKQQSESPFHNLTTIHMFSCRSIKYLFSPLMAELLSNLKDIWISGCNGI

superfamily: SSF52058
1260-1715 SSF52058,LRR

EGSNEISFNNTTATTAVLDQFELSEAGGVSWSLCQYAREIEISKCNVLSSVIPCYAAGQMQKLQVLRVTGCDGMKEVFETQLGTSSNKNRKGGGDEGNGGIPRVNNNVIMLPNLKTLKIYMCGGLEHIFTFSALESLTQLQELKIVGCYGMKVIVKKEEDEYGEQQTTTTTTTKGASSSSSSSSSKKVVVFPRLKSIELFNLPELVGFFLGMNEFRLPSLEEVTIKYCSKMMVFAAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTSGPATSEGTTWSFHNLIELDMELNYDVKKIIPSSELLQLQKLEKIHVSSCYWVEEVFETALEAAGRNGNSGIGFDESSQTTTTTTLFNLRNLREMKLHFLRGLRYIWKSNQWTAFEFPNLTRVHISRCRRLEHVFTSSMVGSLLQLQELDISWCNHMEEVIVKDADVSVEEDKERESDGK

Gene3D: G3DSA:3.80.10.10
1283-1407 G3DSA:3.80.10.10

SEAGGVSWSLCQYAREIEISKCNVLSSVIPCYAAGQMQKLQVLRVTGCDGMKEVFETQLGTSSNKNRKGGGDEGNGGIPRVNNNVIMLPNLKTLKIYMCGGLEHIFTFSALESLTQLQELKIVGC

superfamily: SSF52047
1357-1585 SSF52047,LRR

NGGIPRVNNNVIMLPNLKTLKIYMCGGLEHIFTFSALESLTQLQELKIVGCYGMKVIVKKEEDEYGEQQTTTTTTTKGASSSSSSSSSKKVVVFPRLKSIELFNLPELVGFFLGMNEFRLPSLEEVTIKYCSKMMVFAAGGSTAPQLKYIHTRLGKHTLDQESGLNFHQTSFQSLYGDTSGPATSEGTTWSFHNLIELDMELNYDVKKIIPSSELLQLQKLEKIHVSSC

Gene3D: G3DSA:3.80.10.10
1530-1585 G3DSA:3.80.10.10

SLYGDTSGPATSEGTTWSFHNLIELDMELNYDVKKIIPSSELLQLQKLEKIHVSSC


List of References

B C Meyers, D B Chin, K A Shen, S Sivaramakrishnan, D O Lavelle, Z Zhang, R W Michelmore
The major resistance gene cluster in lettuce is highly duplicated and spans several megabases.
Plant Cell: 1998, 10(11);1817-32
PubMed:9811791 WorldCat.org (P p)

B C Meyers, K A Shen, P Rohani, B S Gaut, R W Michelmore
Receptor-like genes in the major resistance locus of lettuce are subject to divergent selection.
Plant Cell: 1998, 10(11);1833-46
PubMed:9811792 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox