PRGDB00049500 (Xa21)

From PRG Wiki
Jump to: navigation, search
Xa21
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2586084 (U72723)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza longistaminata

Comment?

Oryza longistaminata receptor kinase-like protein (Xa21) gene, complete cds and family member C, pseudogene.

DNA Sequence

ATGATATCACTCCCATTATTGCTCTTCGTCCTGTTGTTCTCTGCGCTGCTGCTCTGCCCTTCAAGCAGTGACGACGATGGTGATGCTGCCGGCGACGAACTCGCGCTGCTCTCTTTCAAGTCATCCCTGCTATACCAGGGGGGCCAGTCGCTGGCATCTTGGAACACGTCCGGCCACGGCCAGCACTGCACATGGGTGGGTGTTGTGTGCGGCCGCCGCCGCCGCCGGCACCCACACAGGGTGGTGAAGCTGCTGCTGCGCTCCTCCAACCTGTCCGGGATCATCTCGCCGTCGCTCGGCAACCTGTCCTTCCTCAGGGAGCTGGACCTCGGCGACAACTACCTCTCCGGCGAGATACCACCGGAGCTCAGCCGTCTCAGCAGGCTTCAGCTGCTGGAGCTGAGCGATAACTCCATCCAAGGGAGCATCCCCGCGGCCATTGGAGCATGCACCAAGTTGACATCGCTAGACCTCAGCCACAACCAACTGCGAGGTATGATCCCACGTGAGATTGGTGCCAGCTTGAAACATCTCTCGAATTTGTACCTTTACAAAAATGGTTTGTCAGGAGAGATTCCATCCGCTTTGGGCAATCTCACTAGCCTCCAGGAGTTTGATTTGAGCTTCAACAGATTATCAGGAGCTATACCTTCATCACTGGGGCAGCTCAGCAGTCTATTGACTATGAATTTGGGACAGAACAATCTAAGTGGGATGATCCCCAATTCTATCTGGAACCTTTCGTCTCTAAGAGCGTTTAGTGTCAGAGAAAACAAGCTAGGTGGTATGATCCCTACAAATGCATTCAAAACCCTTCACCTCCTCGAGGTGATAGATATGGGCACTAACCGTTTCCATGGCAAAATCCCTGCCTCAGTTGCTAATGCTTCTCATTTGACAGTGATTCAGATTTATGGCAACTTGTTCAGTGGAATTATCACCTCGGGGTTTGGAAGGTTAAGAAATCTCACAGAACTGTATCTCTGGAGAAATTTGTTTCAAACTAGAGAACAAGATGATTGGGGGTTCATTTCTGACCTAACAAATTGCTCCAAATTACAAACATTGAACTTGGGAGAAAATAACCTGGGGGGAGTTCTTCCTAATTCGTTTTCCAATCTTTCCACTTCGCTTAGTTTTCTTGCACTTGAATTGAATAAGATCACAGGAAGCATTCCGAAGGATATTGGCAATCTTATTGGCTTACAACATCTCTATCTCTGCAACAACAATTTCAGAGGGTCTCTTCCATCATCGTTGGGCAGGCTTAAAAACTTAGGCATTCTACTCGCCTACGAAAACAACTTGAGCGGTTCGATCCCGTTGGCCATAGGAAATCTTACTGAACTTAATATCTTACTGCTCGGCACCAACAAATTCAGTGGTTGGATACCATACACACTCTCAAACCTCACAAACTTGTTGTCATTAGGCCTTTCAACTAATAACCTTAGTGGTCCAATACCCAGTGAATTATTCAATATTCAAACACTATCAATAATGATCAATGTATCAAAAAATAACTTGGAGGGATCAATACCACAAGAAATAGGGCATCTCAAAAATCTAGTAGAATTTCATGCAGAATCGAATAGATTATCAGGTAAAATCCCTAACACGCTTGGTGATTGCCAGCTCTTACGGTATCTTTATCTGCAAAATAATTTGTTATCTGGTAGCATCCCATCAGCCTTGGGTCAGCTGAAAGGTCTCGAAACTCTTGATCTCTCAAGCAACAATTTGTCAGGCCAGATACCCACATCCTTAGCAGATATTACTATGCTTCATTCCTTGAACCTTTCTTTCAACAGCTTTGTGGGGGAAGTGCCAACCATTGGTGCTTTCGCAGCTGCATCCGGGATCTCAATCCAAGGCAATGCCAAACTCTGTGGTGGAATACCTGATCTACATCTGCCTCGATGTTGTCCATTACTAGAGAACAGAAAACATTTCCCAGTTCTACCTATTTCTGTTTCTCTGGCCGCAGCACTGGCCATCCTCTCATCACTCTACTTGCTTATAACCTGGCACAAGAGAACTAAAAAGGGAGCCCCTTCAAGAACTTCCATGAAAGGCCACCCATTGGTCTCTTATTCGCAGTTGGTAAAAGCAACAGATGGTTTCGCGCCGACCAATTTGTTGGGTTCTGGATCATTTGGCTCAGTATACAAAGGAAAGCTTAATATCCAAGATCATGTTGCAGTGAAGGTACTAAAGCTTGAAAATCCTAAGGCGCTCAAGAGTTTCACTGCCGAATGTGAAGCACTACGAAATATGCGACATCGAAATCTTGTCAAGATAGTTACAATTTGCTCGAGCATTGATAACAGAGGGAACGATTTCAAAGCAATTGTGTATGACTTCATGCCCAACGGCAGTCTGGAAGATTGGATACACCCTGAAACAAATGATCAAGCAGACCAGAGGCACTTGAATCTGCATCGAAGAGTGACCATACTACTTGATGTTGCCTGCGCACTGGACTATCTTCACCGCCATGGCCCTGAACCTGTTGTACACTGTGATATTAAATCAAGCAATGTGCTGTTAGATTCTGATATGGTAGCCCATGTTGGAGATTTTGGGCTTGCAAGAATACTTGTTGATGGGACCTCATTGATACAACAGTCAACAAGCTCGATGGGATTTATAGGGACAATTGGCTATGCAGCACCAGAGTATGGCGTTGGGCTCATTGCATCAACGCATGGAGATATTTACAGCTATGGAATTCTAGTGCTGGAAATAGTAACCGGGAAGCGGCCAACTGACAGTACATTCAGACCCGATTTGGGCCTCCGTCAGTACGTTGAACTGGGCCTACATGGCAGAGTGACGGATGTTGTTGACACGAAGCTCATTTTGGATTCTGAGAACTGGCTGAACAGTACAAATAATTCTCCATGTAGAAGAATCACTGAATGCATTGTTTGGCTGCTTAGACTTGGGTTGTCTTGCTCTCAGGAATTGCCATCGAGTAGAACGCCAACCGGAGATATCATCGACGAACTGAATGCCATCAAACAGAATCTCTCCGGATTGTTTCCAGTGTGTGAAGGTGGGAGCCTTGAATTCTGA


Protein sequences

Name Description Sequence
receptor kinase-like protein receptor kinase-like protein [Oryza longistaminata].

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYLSGEIPPELSRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLYKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPTNAFKTLHLLEVIDMGTNRFHGKIPASVANASHLTVIQIYGNLFSGIITSGFGRLRNLTELYLWRNLFQTREQDDWGFISDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALELNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTIGAFAAASGISIQGNAKLCGGIPDLHLPRCCPLLENRKHFPVLPISVSLAAALAILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWLLRLGLSCSQELPSSRTPTGDIIDELNAIKQNLSGLFPVCEGGSLEF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1009 FAMILY NOT NAMED,FAMILY NOT NAMED

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYLSGEIPPELSRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLYKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPTNAFKTLHLLEVIDMGTNRFHGKIPASVANASHLTVIQIYGNLFSGIITSGFGRLRNLTELYLWRNLFQTREQDDWGFISDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALELNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTIGAFAAASGISIQGNAKLCGGIPDLHLPRCCPLLENRKHFPVLPISVSLAAALAILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWLLRLGLSCSQELPSSRTPTGDIIDELNAIKQ

HMMPanther: PTHR24420:SF474
1-1009 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYLSGEIPPELSRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLYKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPTNAFKTLHLLEVIDMGTNRFHGKIPASVANASHLTVIQIYGNLFSGIITSGFGRLRNLTELYLWRNLFQTREQDDWGFISDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALELNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTIGAFAAASGISIQGNAKLCGGIPDLHLPRCCPLLENRKHFPVLPISVSLAAALAILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWLLRLGLSCSQELPSSRTPTGDIIDELNAIKQ

Seg: seg
3-38 seg

SLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLS

superfamily: SSF52058
26-333 L domain-like,LRR

DGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYLSGEIPPELSRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLYKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPTNAFKTLHLLEVIDMGTNRFHGKIPASVANASHLTVIQIYGNLFSGIITSGFGRLRNLTELYLWRNLF

HMMPfam: PF08263
IPR013210
30-70 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

AGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVC

Gene3D: G3DSA:3.80.10.10
32-334 no description

DELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYLSGEIPPELSRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLYKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPTNAFKTLHLLEVIDMGTNRFHGKIPASVANASHLTVIQIYGNLFSGIITSGFGRLRNLTELYLWRNLFQ

Seg: seg
66-82 seg

VGVVCGRRRRRHPHRVV

HMMSmart: SM00369
IPR003591
102-125 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSFLRELDLGDNYLSGEIPPELSR

HMMPfam: PF00560
IPR001611
105-126 LRR_1
Leucine-rich repeat

LRELDLGDNYLSGEIPPELSRL

Seg: seg
122-135 seg

ELSRLSRLQLLELS

HMMSmart: SM00369
IPR003591
126-150 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSRLQLLELSDNSIQGSIPAAIGAC

HMMPfam: PF12799
128-164 LRR_4,Leucine Rich repeats (2 copies)

RLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLR

HMMSmart: SM00369
IPR003591
151-174 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

TKLTSLDLSHNQLRGMIPREIGAS

FPrintScan: PR00019
153-166 LEURICHRPT,Leucine-rich repeat signature

LTSLDLSHNQLRGM

HMMPfam: PF13516
175-198 LRR_6,Leucine Rich repeat

LKHLSNLYLYKNGLSGEIPSALGN

HMMSmart: SM00369
IPR003591
199-223 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTSLQEFDLSFNRLSGAIPSSLGQL

HMMPfam: PF13855
200-260 LRR_8,Leucine rich repeat

TSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKL

HMMSmart: SM00369
IPR003591
247-271 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLRAFSVRENKLGGMIPTNAFKT

HMMSmart: SM00369
IPR003591
320-343 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLTELYLWRNLFQTREQDDWGF

Gene3D: G3DSA:3.80.10.10
345-498 no description

SDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALELNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTL

superfamily: SSF52058
349-631 L domain-like,LRR

NCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALELNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTIGAFAAASGISIQGNAKLCG

HMMSmart: SM00369
IPR003591
350-373 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

CSKLQTLNLGENNLGGVLPNSFSN

HMMPfam: PF00560
IPR001611
352-374 LRR_1
Leucine-rich repeat

KLQTLNLGENNLGGVLPNSFSNL

Seg: seg
356-365 seg

LNLGENNLGG

Seg: seg
367-383 seg

LPNSFSNLSTSLSFLAL

HMMSmart: SM00369
IPR003591
399-423 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LIGLQHLYLCNNNFRGSLPSSLGRL

HMMPfam: PF00560
IPR001611
402-423 LRR_1
Leucine-rich repeat

LQHLYLCNNNFRGSLPSSLGRL

HMMSmart: SM00369
IPR003591
447-470 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTELNILLLGTNKFSGWIPYTLSN

Seg: seg
467-486 seg

TLSNLTNLLSLGLSTNNLSG

HMMSmart: SM00369
IPR003591
471-495 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLLSLGLSTNNLSGPIPSELFNI

Gene3D: G3DSA:3.80.10.10
503-634 no description

NVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTIGAFAAASGISIQGNAKLCGGIP

HMMSmart: SM00369
IPR003591
520-544 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLVEFHAESNRLSGKIPNTLGDC

Seg: seg
545-557 seg

QLLRYLYLQNNLL

HMMPfam: PF13855
546-604 LRR_8,Leucine rich repeat

LLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNS

HMMSmart: SM00369
IPR003591
568-591 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKGLETLDLSSNNLSGQIPTSLAD

FPrintScan: PR00019
568-581 LEURICHRPT,Leucine-rich repeat signature

LKGLETLDLSSNNL

Seg: seg
612-623 seg

IGAFAAASGISI

Seg: seg
654-674 seg

LPISVSLAAALAILSSLYLLI

Gene3D: G3DSA:3.30.200.20
688-759 no description

TSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNM

superfamily: SSF56112
IPR011009
694-1002 Protein kinase-like (PK-like)
Protein kinase-like domain

PLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWLLRLGLSCSQELPSSRTPTGDIID

HMMSmart: SM00220
IPR002290
708-1007 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWLLRLGLSCSQELPSSRTPTGDIIDELNAI

HMMSmart: SM00219
IPR020635
708-1004 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWLLRLGLSCSQELPSSRTPTGDIIDEL

ProfileScan: PS50011
IPR000719
708-979 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDSTFRPDLGLRQYVELGLHGRVTDVVDTKLILDSENWLNSTNNSPCRRITECIVWL

HMMPfam: PF00069
IPR000719
712-926 Pkinase,Ser-thr
Protein kinase, catalytic domain

NLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSFTAECEALRNMRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDST

PatternScan: PS00107
IPR017441
714-736 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGSFGSVYKGKLNIQDHVAVK

Gene3D: G3DSA:1.10.510.10
760-926 no description

RHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWIHPETNDQADQRHLNLHRRVTILLDVACALDYLHRHGPEPVVHCDIKSSNVLLDSDMVAHVGDFGLARILVDGTSLIQQSTSSMGFIGTIGYAAPEYGVGLIASTHGDIYSYGILVLEIVTGKRPTDST

PatternScan: PS00108
IPR008271
838-850 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHCDIKSSNVLL


List of References

W Y Song, G L Wang, L L Chen, H S Kim, L Y Pi, T Holsten, J Gardner, B Wang, W X Zhai, L H Zhu, C Fauquet, P Ronald
A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21.
Science: 1995, 270(5243);1804-6
PubMed:8525370 WorldCat.org (P p)

W Y Song, L Y Pi, G L Wang, J Gardner, T Holsten, P C Ronald
Evolution of the rice Xa21 disease resistance gene family.
Plant Cell: 1997, 9(8);1279-87
PubMed:9286106 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox