PRGDB00049501 (receptor kinase-like protein)

From PRG Wiki
Jump to: navigation, search
receptor kinase-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2586079 (U72725)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza longistaminata

Comment?

Oryza longistaminata receptor kinase-like protein gene, family member A1, complete cds.

DNA Sequence

ATGATATCACTCCCATTATTGCTCTTCGTCCTGTTGTTCTCTGCGCTGCTGCTCTGCCCTTCAAGCAGTGACGACGATGGTGATGCTGCCGGCGACGAACTCGCGCTGCTCTCTTTCAAGTCATCCCTGCTATACCAGGGGGGCCAGTCGCTGGCATCTTGGAACACGTCCGGCCACGGCCAGCACTGCACATGGGTGGGTGTTGTGTGCGGCCGCCGGCACCCGCACAGGGTGGTGAAGCTGCGGCTGCGCTCGTCCAACCTGACCGGGATCATCTCGCCATCGCTGGGCAACCTATCCTTCCTCAGGACGCTGCAACTCAGCAACAACCACCTGTCCGGCAAGATACCCCAGGAGCTCAGCCGTCTCAGCAGGCTCCAGCAGCTGGTACTGAATTTCAACAGCCTATCGGGTGAGATTCCAGCTGCTTTGGGCAATCTAACCAGTCTCTCAGTTCTTGAGCTGACTAACAATACACTGTCTGGTTCTATCCCTTCATCCCTGGGCAAGCTCACCGGCCTCTATAATCTTGCACTGGCTGAAAATATGCTGTCTGGTTCCATCCCTACGTCTTTCGGCCAATTGCGCAGATTATCTTTCCTTAGCTTAGCCTTCAACCACTTAAGTGGAGCGATCCCAGATCCTATTTGGAACATCTCCTCTCTCACCATATTTGAAGTCGTGTCCAACAACCTAACTGGTACACTGCCTGCAAATGCATTCAGTAATCTTCCTAATCTGCAGCAGGTTTTCATGTACTACAACCATTTTCATGGTCCTATCCCTGCATCGATTGGTAATGCTTCCAGCATCTCAATATTTACCATTGGTTTAAACTCTTTTAGCGGTGTTGTTCCACCGGAGATTGGAAGGATGAGAAATCTTCAGAGACTAGAGCTTCCAGAAACTCTTTTGGAAGCTGAAGAAACAAATGATTGGAAATTCATGACGGCATTGACAAATTGCTCCAATCTTCAAGAAGTGGAACTGGCAGGTTGCAAATTTGGTGGAGTCCTCCCTGATTCTGTTTCCAATCTTTCCTCTTCGCTTGTATCTCTCTCCATTAGAGATAACAAAATTTCAGGGAGCTTACCTAGAGATATCGGTAATCTCGTTAATTTACAATATCTTTCTCTCGCTAACAACTCCTTGACAGGATCCCTTCCCTCTTCCTTCAGCAAGCTTAAAAATTTACGTCGTCTCACTGTAGATAACAACAGGTTAATTGGTTCTCTCCCATTGACTATCGGTAATCTTACACAACTAACTAATATGGAGGTCCAATTTAATGCCTTTGGTGGTACAATACCAAGCACACTTGGAAACCTGACCAAGCTGTTTCAAATAAATCTTGGCCACAATAACTTTATAGGGCAAATTCCCATTGAAATATTTAGCATTCCCGCACTCTCTGAAATTTTGGATGTGTCCCATAATAACTTGGAGGGATCAATACCAAAAGAAATAGGGAAACTTAAAAATATTGTCGAATTCCATGCTGATTCGAACAAATTATCGGGTGAGATCCCTAGCACCATTGGTGAATGCCAACTTCTGCAGCATCTTTTCCTGCAAAACAATTTCTTAAATGGTAGCATCCCAATAGCTCTGACTCAGTTGAAAGGTCTGGACACACTTGATCTCTCAGGCAACAATTTGTCAGGTCAGATACCTATGTCCTTAGGGGACATGACTCTGCTCCACTCGCTGAACCTTTCGTTCAACAGCTTCCACGGTGAAGTGCCAACCAATGGTGTTTTTGCAAATGCTTCTGAAATTTACATCCAAGGCAATGCCCATATTTGCGGTGGCATACCTGAACTACATCTTCCGACGTGTTCCTTAAAATCAAGAAAGAAAAGGAAACATCAAATTCTGCTGTTAGTGGTTGTTATCTGTCTCGTTTCGACACTTGCCGTCTTTTCGTTACTCTACATGCTTCTAACCTGTCATAAGAGAAGAAAGAAAGAAGTCCCTGCAACGACATCCATGCAAGGCCACCCAATGATCACTTACAAGCAGCTGGTAAAAGCAACGGATGGTTTTTCGTCCAGCCATTTGTTGGGTTCTGGATCTTTTGGCTCTGTTTACAAAGGAGAATTTGATAGTCAAGATGGTGAAATCACAAGTCTTGTTGCCGTGAAGGTACTAAAGCTAGAAACTCCTAAGGCACTCAAGAGTTTCACGGCCGAATGCGAAACACTACGAAATACGCGACACCGGAATCTTGTCAAGATAGTTACGATTTGCTCGAGCATCGATAACAGAGGGAATGATTTCAAAGCAATTGTGTATGACTTCATGCCCAATGGCAGTCTGGAAGATTGGCTACACCCTGAAACAAATGATCAAGCAGAGCAAAGGCACTTGACTCTGCATCAGAGAGTGACCATACTACTTGATGTTGCATGTGCATTGGAGCATCTTCACTTCCATGGCCCTGAACCTATTGTACACTGTGATATTAAATCAAGCAATGTGTTGTTAGATGCTGATATGGTAGCTCATGTTGGAGACTTTGGACTTGCAAGAATACTTGTTGAGGGAAGCTCATTGATGCAACAGTCAACAAGTTCGATGGGAATCAGGGGGACAATTGGTTACGCAGCACCAGAGTATGGTGTCGGGAACACTGCCTCGACACATGGAGATATTTACAGTTATGGAATTCTAGTGTTGGAAACAGTAACCGGGATGCGGCCGGCAGACAGTACATTCAGAACTGGATTGAGCCTCCGTCAGTACGTTGAACCGGGTCTACATGGTAGACTAATGGATGTTGTTGACAGGAAGCTTGGTTTGGATTCCGAGAAATGGCTTCAGGCTCGAGATGTTTCGCCACGCAGCAGTATTACTGAATGCCTTGTTTCACTGCTTAGACTTGGGCTGTCTTGCTCTCAGGAATTGCCATCGAGTAGAACGCAAGCCGGAGATGTCATCAATGAACTGCGTGCCATCAAAGAGTCTCTCTCGATGTCATCCGACATGTGA


Protein sequences

Name Description Sequence
receptor kinase-like protein receptor kinase-like protein [Oryza longistaminata].

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLSNNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPSSLGKLTGLYNLALAENMLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSNNLTGTLPANAFSNLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLLEAEETNDWKFMTALTNCSNLQEVELAGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKRKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPRSSITECLVSLLRLGLSCSQELPSSRTQAGDVINELRAIKESLSMSSDM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-996 PTHR24420:SF474,SUBFAMILY NOT NAMED

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLSNNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPSSLGKLTGLYNLALAENMLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSNNLTGTLPANAFSNLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLLEAEETNDWKFMTALTNCSNLQEVELAGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKRKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPRSSITECLVSLLRLGLSCSQELPSSRTQAGDVINELRAIKESLSMSSDM

HMMPanther: PTHR24420
1-996 PTHR24420,FAMILY NOT NAMED

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLSNNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPSSLGKLTGLYNLALAENMLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSNNLTGTLPANAFSNLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLLEAEETNDWKFMTALTNCSNLQEVELAGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKRKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPRSSITECLVSLLRLGLSCSQELPSSRTQAGDVINELRAIKESLSMSSDM

superfamily: SSF52058
26-320 SSF52058,LRR

DGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLSNNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPSSLGKLTGLYNLALAENMLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSNNLTGTLPANAFSNLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLLEAEETNDWKFMTALT

HMMPfam: PF08263
IPR013210
30-70 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

AGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVC

Gene3D: G3DSA:3.80.10.10
32-301 G3DSA:3.80.10.10

DELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLSNNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPSSLGKLTGLYNLALAENMLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSLTIFEVVSNNLTGTLPANAFSNLPNLQQVFMYYNHFHGPIPASIGNASSISIFTIGLNSFSGVVPPEIGRMRNLQRLELP

HMMPfam: PF13516
99-121 LRR_6,Leucine Rich repeat

LSFLRTLQLSNNHLSGKIPQELS

Gene3D: G3DSA:3.80.10.10
319-602 G3DSA:3.80.10.10

LTNCSNLQEVELAGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHIC

superfamily: SSF52058
321-603 SSF52058,LRR

NCSNLQEVELAGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICG

HMMPfam: PF12799
373-408 LRR_4,Leucine Rich repeats (2 copies)

NLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRL

HMMPfam: PF00560
IPR001611
472-492 LRR_1
Leucine-rich repeat

EILDVSHNNLEGSIPKEIGKL

HMMPfam: PF13855
519-576 LRR_8,Leucine rich repeat

LQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNS

Gene3D: G3DSA:2.60.120.200
IPR013320
609-688 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

HLPTCSLKSRKKRKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLL

superfamily: SSF56112
IPR011009
652-991 Kinase_like
Protein kinase-like domain

KRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPRSSITECLVSLLRLGLSCSQELPSSRTQAGDVINELRAIKESLS

ProfileScan: PS50011
IPR000719
682-951 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPRSSI

HMMPfam: PF00069
IPR000719
685-905 Pkinase,Ser-thr
Protein kinase, catalytic domain

SHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADST

PatternScan: PS00107
IPR017441
688-715 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGSFGSVYKGEFDSQDGEITSLVAVK

Gene3D: G3DSA:3.30.200.20
689-738 G3DSA:3.30.200.20

GSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTAECETLRNT

Gene3D: G3DSA:1.10.510.10
739-924 G3DSA:1.10.510.10

RHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVTILLDVACALEHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILVEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRL

PatternScan: PS00108
IPR008271
817-829 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHCDIKSSNVLL


List of References

W Y Song, G L Wang, L L Chen, H S Kim, L Y Pi, T Holsten, J Gardner, B Wang, W X Zhai, L H Zhu, C Fauquet, P Ronald
A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21.
Science: 1995, 270(5243);1804-6
PubMed:8525370 WorldCat.org (P p)

W Y Song, L Y Pi, G L Wang, J Gardner, T Holsten, P C Ronald
Evolution of the rice Xa21 disease resistance gene family.
Plant Cell: 1997, 9(8);1279-87
PubMed:9286106 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox