PRGDB00049545 (leucine-rich repeat family protein)

From PRG Wiki
Jump to: navigation, search
leucine-rich repeat family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145334746 (NM_001085250)
Gene Class Other
Domain Type LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat family protein (AT5G45510) mRNA, complete cds.

DNA Sequence

ATGTCTGATCCGTTGAAGATGGCGGCCGAGACGGAGGAGATTAAACCAGTTCCAGCAGCAATGGGAGAAAAGAAGGATGTGGTGTTGTGTAAGAAGATAGTGGAAACTCTGGGAGGAGGTGGTGATCAAAGAGTATTGCTGGTTGGCGAAGCTGGGATCGGGAAGACAAGGATGGCACAAATGGTTGACAAAGAAGCCTCTAAGGATGTTCTTTGCTACCAGACTCTCTGGTTGCATCTCAACAGGAAGTTTAAAGTCAACGACAACTATATCAAGGAGAAGAAGTTTGAAGACGAATGGTCTCTTTATGAGAACATAGCTTCACAGCTATCTTTATACTCTGATTTTGAAGAGACTGAAGTCGGTGAAAGAGATGAAGATGAGGAAGAGGAGAAGAAGGTTGAAGATTTGCTCAAGGATTTGAAGCCCAAGATTGAGAAGTATCTCTTGGAAAAGAAGGAAGCCGTCGTGAAAAAATTGGAGGATGACAAGAAGAAGAAGGAGAAGGAAGCCGCAGAGAAACTGGAGGCTGAGAAAAAACTGGTGGATCCGGCTGCGAAAAAAGCAAAAGACCATGGAAACAAGAATCCAACCGATGCCGCAAAGGAGAAAACGACTCAAGTAGTAGCCGGAGGAGAGGATAAAGCTCAGACATCATCTGAAAGAAAGCCGTATCTTCTTTTGATTCTTGACGATGAAGGAATGACCAGTGAGTACGAGGTGATGGTGCATTTAGGCCTTGAGGATTTTCTGAAAGATCACACACCTCGAAAAATCCTTATTACAAGAAGACAAGAAACTGAGGAGGCTACAAAATCTGGTGAGCATGCTGAGGGGGAGGCAAATGATTCGCAATCCGGGGAAAAGAAAGAGGACACAGATGGTGAAGACGAAATTAGATCAGCTGATAAGGAGGAACCTGAGTCTCAAGCCCGGGTCAAAACAGAGGAGAAACATGAAAAAGTTGTACCTCCTACCATAGATGACTTATGGGGGAGCACAAACACTTATGGTGAAATTACGTTCCAGACCACAAATGAGTCACAAGATTTACTTGAATCATTCAACCTAAAGGAGGCAGAGGCTTTATTTACTTCGTCCATGTTTTTCAAGGATATGCCAAATTTTTTCTTTGACCCCGTTCCTGGGACTGATGAGAAACTGTTAAACCACATGCTGAAAAAGAGCAAGAGTTTGCCAGCTGCAATCAACGTGCTCGCCAAGTCCCTAGAGTACACTGTCAAGAGCAAGTCCTATAAGCTTAATAAGGACGAAGAAGAGAGGTTACTAAAAGAAAAGATAGAAATGGTTCTCTCGGCTGAGCGGGGTAATCCATCCGACCAGGAATCTAGTTCTGAGAGCCCTAAGAAAGCAAGTGGAGAAAATCCAATCCTGCTTCTTGCATACAAGCTGTTCAAAACCGATGGTCCATTGAAGGATACAATATTGGATTGTTTTTGGCATAGCTTGGACTTCTTTGAGCATTGTGGCTGTGTTTACTACCGTGACCTGATCACACAATGGATACTTGAAGGCTACTTTGATCCTGTTAGGTCTGTCGAAAAGGCGTACCAGGATGGTCATTCTATCTTCATGGAGCTTATAGACCGCGGAATGCTGAAGATACAAGAAAACAATGTGGTAGTACCAGAGATGGCGATGAGAAATGTAATTGATCCTCGACGTGGTGGGCATTTAGGGAAATCTCGGCTTGGATTTTCTAGAGTCTATGGTGGTAACAAGAGAAAAGGAATAGGGAAAATCACCCAACTTGATGATATGATTAAAACAGTGCAAGCAAAGAAAGGAGACAAGATTACCACGATTCTGGTTAGTGGAGATCGTCTGCGTCGCGTAACTCCTAAAAAGTTCTTCAAGAATCTGAAAGAGCTTGAAGTACTTGGCCTTTTTGAGCCCACAGTAAAACCATTTGTCCCGTCTTTTTCAGATCAGCTCAAACTCCTCCGGGTTCTTATAATCAGGGACTGTGATCTCCTGAAAAGCATTGAAGAGCTTAAGGCTCTTACAAAGCTAAATACTCTTGAAGTTTCTGGTGCTAGCTCCCTGAGCAAAATATCTGAAAAATTCTTTGAGTCATTTCCTGAACTCCGAAGTCTTCACCTCTCTGGGCTTAAGATCGAGTCTTCCCCTCCCAGTATTTCTGGCCTGAAGGAACTTCACTGTCTCATCATCAAAGACTGCCCTTTATTGCAAGATCTGCCAAACATACAAGAACTAGTAAATCTTGAGGTTGTTGATGTTTCTGGTGCTAGTGGGCTTCGAACTTGTTTCGACAACGCAGATGGTGCCAAGAAAAACAAGAGCAAAAACAAAAACTTTTATCTTCTTACAAAACTTCAGCATCTTGACTTCTCGGGGAGCCAAATAGAGCGACTGCCAATATTCCAGGATTCTGCGGTGGCCGCCAAGCTTCACTCCTTGACTCGGCTCTTGTTGCGCAACTGTAGCAAATTGAGAAGGTTGCCTAGTTTGAAGCCCTTGTCAGGACTTCAAATTCTTGATCTTTCTGGCACTACGAGCTTAGTGGAAATGCTTGAAGTGTGCTTCGAGGATAAGCTTGAACTCAAAACTCTTAATCTCTCGGGAACTAATCTTAGCGAGTTGGCTACCACCATCGAGGACCTGTCCAGTCTCAACGAACTCCTCCTACGTGATTGCATCAACCTAGATGCCATCCCAAACATCGAGAAACTAGAAAATCTCGAAGTCATTGATGTTTCCGGCAGTGCCAAGCTGGCAAAGATTGAGGGATCATTTGAGAAAATGTTTTACCTACGTGTAGTGGATCTGTCTGGAACCCAAGTGGAGACACCAGAGTTGCCAGCGGATACCAAAATCCATTGTCTGAAGCGTTTTACTCGGGCAGATGGAAAATGTTTTGAACGTGACACATGGAGAGAAATAAAGGAAGACATTGAACGTGATAGGTCTGAGAATGCCAGCTCCTCTGATGCAGTTGTTATATCTCAAGAAATCACAGAAAAGAAGCCTGTAGAAATAAGAGAGGTTGAATCGAATGCACCTCGCGCCAGTGATTGTACCGAGAAAGTAGATGTCAACAAGGAACGTCTTCTTAAAGTCCCCATAGATAGGGCTCTATATCAGAAGGCACTAACATCACTTGTTGATTCCAAAATTCCACAAGAAGAAGTCTTGGAGATCAATGAAACTAATAAGCTAGATGAGGAAGCACTAGCTAGTGCTGAGTTTGTGTCTTTTGTGGACTGTACTCCTGAAAGGGTCAAATCTATCTTTGAGAAGGCCAAATTGGTGAAGGGTTGCTGGCTAAGGATGTGCTTTGACATAAAAGACCCTTTCGATGGTGTGGATGAGGAGAACTTGAAATCACTGGAGACTTTATCGATTACAAACCTTCTCTCATTGGAGACTATAAGCTTTATTGCTAAGTTAGAGAATCTGAAGAACCTAAGCTTAGATTGCTGCCCGAAAATCAAAACGATTTTCCCGGAGATGCCTGCCAGCCTACCAGTCCTGAATTTAAAGCATTGTGAGAACCTGGAGAAAGTTGTTGTAGGAGTTGAAGTGTCAACTCACACTAATCTGGATTTGAAAGTGGAGAATTGTCCAAAATTCGGGGTCGTATGTGCTTGA


Protein sequences

Name Description Sequence
leucine-rich repeat family protein leucine-rich repeat family protein [Arabidopsis thaliana].

MSDPLKMAAETEEIKPVPAAMGEKKDVVLCKKIVETLGGGGDQRVLLVGEAGIGKTRMAQMVDKEASKDVLCYQTLWLHLNRKFKVNDNYIKEKKFEDEWSLYENIASQLSLYSDFEETEVGERDEDEEEEKKVEDLLKDLKPKIEKYLLEKKEAVVKKLEDDKKKKEKEAAEKLEAEKKLVDPAAKKAKDHGNKNPTDAAKEKTTQVVAGGEDKAQTSSERKPYLLLILDDEGMTSEYEVMVHLGLEDFLKDHTPRKILITRRQETEEATKSGEHAEGEANDSQSGEKKEDTDGEDEIRSADKEEPESQARVKTEEKHEKVVPPTIDDLWGSTNTYGEITFQTTNESQDLLESFNLKEAEALFTSSMFFKDMPNFFFDPVPGTDEKLLNHMLKKSKSLPAAINVLAKSLEYTVKSKSYKLNKDEEERLLKEKIEMVLSAERGNPSDQESSSESPKKASGENPILLLAYKLFKTDGPLKDTILDCFWHSLDFFEHCGCVYYRDLITQWILEGYFDPVRSVEKAYQDGHSIFMELIDRGMLKIQENNVVVPEMAMRNVIDPRRGGHLGKSRLGFSRVYGGNKRKGIGKITQLDDMIKTVQAKKGDKITTILVSGDRLRRVTPKKFFKNLKELEVLGLFEPTVKPFVPSFSDQLKLLRVLIIRDCDLLKSIEELKALTKLNTLEVSGASSLSKISEKFFESFPELRSLHLSGLKIESSPPSISGLKELHCLIIKDCPLLQDLPNIQELVNLEVVDVSGASGLRTCFDNADGAKKNKSKNKNFYLLTKLQHLDFSGSQIERLPIFQDSAVAAKLHSLTRLLLRNCSKLRRLPSLKPLSGLQILDLSGTTSLVEMLEVCFEDKLELKTLNLSGTNLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLAKIEGSFEKMFYLRVVDLSGTQVETPELPADTKIHCLKRFTRADGKCFERDTWREIKEDIERDRSENASSSDAVVISQEITEKKPVEIREVESNAPRASDCTEKVDVNKERLLKVPIDRALYQKALTSLVDSKIPQEEVLEINETNKLDEEALASAEFVSFVDCTPERVKSIFEKAKLVKGCWLRMCFDIKDPFDGVDEENLKSLETLSITNLLSLETISFIAKLENLKNLSLDCCPKIKTIFPEMPASLPVLNLKHCENLEKVVVGVEVSTHTNLDLKVENCPKFGVVCA


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
31-75 G3DSA:3.40.50.300

KKIVETLGGGGDQRVLLVGEAGIGKTRMAQMVDKEASKDVLCYQT

FPrintScan: PR00364
IPR000767
44-59 DISEASERSIST
Disease resistance protein

RVLLVGEAGIGKTRMA

FPrintScan: PR00364
IPR000767
396-410 DISEASERSIST
Disease resistance protein

SKSLPAAINVLAKSL

superfamily: SSF52058
500-1178 SSF52058,LRR

YYRDLITQWILEGYFDPVRSVEKAYQDGHSIFMELIDRGMLKIQENNVVVPEMAMRNVIDPRRGGHLGKSRLGFSRVYGGNKRKGIGKITQLDDMIKTVQAKKGDKITTILVSGDRLRRVTPKKFFKNLKELEVLGLFEPTVKPFVPSFSDQLKLLRVLIIRDCDLLKSIEELKALTKLNTLEVSGASSLSKISEKFFESFPELRSLHLSGLKIESSPPSISGLKELHCLIIKDCPLLQDLPNIQELVNLEVVDVSGASGLRTCFDNADGAKKNKSKNKNFYLLTKLQHLDFSGSQIERLPIFQDSAVAAKLHSLTRLLLRNCSKLRRLPSLKPLSGLQILDLSGTTSLVEMLEVCFEDKLELKTLNLSGTNLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLAKIEGSFEKMFYLRVVDLSGTQVETPELPADTKIHCLKRFTRADGKCFERDTWREIKEDIERDRSENASSSDAVVISQEITEKKPVEIREVESNAPRASDCTEKVDVNKERLLKVPIDRALYQKALTSLVDSKIPQEEVLEINETNKLDEEALASAEFVSFVDCTPERVKSIFEKAKLVKGCWLRMCFDIKDPFDGVDEENLKSLETLSITNLLSLETISFIAKLENLKNLSLDCCPKIKTIFPEMPASLPVLNLKHCE

Gene3D: G3DSA:3.80.10.10
604-756 G3DSA:3.80.10.10

DKITTILVSGDRLRRVTPKKFFKNLKELEVLGLFEPTVKPFVPSFSDQLKLLRVLIIRDCDLLKSIEELKALTKLNTLEVSGASSLSKISEKFFESFPELRSLHLSGLKIESSPPSISGLKELHCLIIKDCPLLQDLPNIQELVNLEVVDVSG

HMMPanther: PTHR23155
651-1176 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QLKLLRVLIIRDCDLLKSIEELKALTKLNTLEVSGASSLSKISEKFFESFPELRSLHLSGLKIESSPPSISGLKELHCLIIKDCPLLQDLPNIQELVNLEVVDVSGASGLRTCFDNADGAKKNKSKNKNFYLLTKLQHLDFSGSQIERLPIFQDSAVAAKLHSLTRLLLRNCSKLRRLPSLKPLSGLQILDLSGTTSLVEMLEVCFEDKLELKTLNLSGTNLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLAKIEGSFEKMFYLRVVDLSGTQVETPELPADTKIHCLKRFTRADGKCFERDTWREIKEDIERDRSENASSSDAVVISQEITEKKPVEIREVESNAPRASDCTEKVDVNKERLLKVPIDRALYQKALTSLVDSKIPQEEVLEINETNKLDEEALASAEFVSFVDCTPERVKSIFEKAKLVKGCWLRMCFDIKDPFDGVDEENLKSLETLSITNLLSLETISFIAKLENLKNLSLDCCPKIKTIFPEMPASLPVLNLKH

Gene3D: G3DSA:3.80.10.10
776-947 G3DSA:3.80.10.10

KNKNFYLLTKLQHLDFSGSQIERLPIFQDSAVAAKLHSLTRLLLRNCSKLRRLPSLKPLSGLQILDLSGTTSLVEMLEVCFEDKLELKTLNLSGTNLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLAKIEGSFEKMFYLRVVDLSGTQVETPEL

FPrintScan: PR00364
IPR000767
832-848 DISEASERSIST
Disease resistance protein

KPLSGLQILDLSGTTSL

Gene3D: G3DSA:3.80.10.10
1090-1182 G3DSA:3.80.10.10

SIFEKAKLVKGCWLRMCFDIKDPFDGVDEENLKSLETLSITNLLSLETISFIAKLENLKNLSLDCCPKIKTIFPEMPASLPVLNLKHCENLEK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox