PRGDB00049548 (ADR1-L1)

From PRG Wiki
Jump to: navigation, search
ADR1-L1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145323591 (NM_001036704)
Gene Class RPW8-NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ADR1-L1 (ADR1-LIKE 1); ATP binding / protein binding (ADR1-L1) mRNA, complete cds.

DNA Sequence

ATGGCCATCACCGATTTTTTCGCCGGTGAAATTGCGACGGAGCTCCTGAAGCAGCTCTTTACGATATCTACAACGGCGTGGAGATACAAAAACACCGCCAAACAACTCCTCACCTTGATCGATAGCATTCGACCGACGATCAAGGAGATTCAATACAGCGGCGTGGAGCTTCCTGCTCACCGCCAAGCTCAAATCGGTATGCTCTTCGATACTTTAGAGAAAGGCAAGAAGCTCACTGACAAAGTCCTTAGCTCTAAGCGATGGAATTTATATCGACAGCTAACCCTAGCCAGAAAAATGGAGAAGCTAGAGAAGACCATCTCTAATTTCCTTAAAAATGAGGTCTTTACACATATCCTCGCTGACGTTCATCATCTCCGGGCCGATACCAGTGTGCGTTTGGATCGGGTTGACATGAGCCTCGACAGGGTGATTCAGCAAGTGGGTTCCATGAAAATTGGGGGAGGTGGCTTGATATCAGAGGCCATGAAGAGAGCCGAGGCTATGGAGATTGAGACCAACGACGATTCGGAGAAATTTGGGGTTGGATTGGAATTGGGAAAGGTTAAGGTTAAGAAGATGATGTTCGAATCTCAAGGAGGGGTTTTTGGGATCAGTGGAATGGGCGGTGTTGGTAAAACCACTCTTGCCAAAGAACTTCAACGGGACCATGAAGTCCAATGTCACTTTGAGAACCGGATTTTGTTTCTGACTGTATCACAATCTCCGCTTCTTGAGGAGCTGAGGGAACTTATATGGGGTTTCTTATCTGGTTGTGAAGCTGGAAATCCTGTTCCTGACTGTAATTTTCCGTTTGATGGCGCGCGTAAGCTCGTGATTCTTGATGATGTTTGGACCACACAGGCCCTGGACCGCTTGACCTCGTTTAAGTTTCCTGGTTGCACAACTCTTGTGGTCTCACGATCCAAACTCACTGAGCCTAAATTCACTTATGATGTCGAAGTACTGAGTGAAGATGAAGCAATCTCTCTCTTCTGTCTCTGTGCTTTCGGTCAGAAATCTATCCCTCTTGGTTTCTGCAAAGATCTGGTTAAGCAGGTTGCTAATGAATGTAAAGGGCTTCCTTTAGCTCTCAAAGTCACGGGTGCTTCATTAAATGGCAAACCTGAAATGTACTGGAAGGGCGTATTGCAGAGGTTATCAAAAGGTGAACCTGCTGATGACTCTCACGAGAGTAGATTGCTTCGTCAAATGGAAGCTAGTCTAGACAATCTCGACCAGACGACCAAAGATTGTTTCTTGGATCTTGGCGCCTTCCCTGAAGACAGGAAGATTCCTCTTGATGTTCTCATCAACATTTGGATTGAGTTACATGATATAGATGAAGGAAATGCTTTTGCCATCCTTGTTGATTTGTCACACAAGAATCTCCTTACTCTTGGGAAGGATCCACGGCTTGGCTCTTTGTACGCAAGCCACTATGATATATTTGTGACACAGCATGATGTTCTGCGAGACCTAGCTCTTCATTTAAGCAATGCAGGGAAAGTAAACAGAAGAAAGCGGTTGCTGATGCCGAAAAGAGAGTTAGATCTTCCAGGAGATTGGGAAAGGAACAATGATGAGCATTACATTGCCCAGATTGTCTCTATTCATACTGGGGAAATGAATGAAATGCAATGGTTTGACATGGAGTTCCCCAAGGCAGAGATTCTAATATTGAACTTCTCTTCAGACAAGTATGTTCTTCCGCCTTTTATCAGTAAGATGAGCCGGCTTAAGGTCCTAGTGATTATCAACAACGGCATGTCTCCCGCGGTTCTCCATGACTTTTCAATATTTGCTCATTTGTCGAAACTAAGAAGTCTCTGGCTAGAGAGGGTTCACGTCCCTCAACTCTCCAACTCAACCACCCCCTTGAAAAATCTCCACAAGATGTCTTTGATTCTGTGCAAGATCAATAAAAGTTTTGATCAAACCGGACTTGACGTGGCAGATATCTTCCCAAAATTGGGCGATCTGACAATAGATCACTGTGATGATCTCGTGGCACTACCTTCAAGCATTTGCGGACTGACCTCCCTTAGCTGCTTAAGCATAACAAATTGTCCACGCCTCGGTGAATTGCCCAAGAACCTCAGTAAGCTACAAGCTCTCGAAATCTTAAGGCTATATGCTTGCCCTGAGCTAAAGACATTACCTGGAGAAATATGTGAGCTTCCTGGGCTTAAGTATCTCGACATCTCACAATGTGTCAGCCTGAGTTGTCTTCCAGAGGAAATAGGAAAGCTAAAGAAGCTTGAGAAGATCGACATGAGAGAATGTTGCTTCTCGGATAGACCGAGCTCTGCTGTTTCACTGAAGTCTCTGCGCCATGTAATCTGCGATACCGACGTTGCATTTATGTGGGAAGAAGTTGAGAAGGCTGTTCCAGGGTTAAAGATCGAAGCTGCTGAGAAATGCTTCAGCCTAGACTGGCTTGACGAATAA


Protein sequences

Name Description Sequence
ADR1-L1 (ADR1-LIKE 1); ATP binding / protein binding ADR1-L1 (ADR1-LIKE 1); ATP binding / protein binding [Arabidopsis thaliana].

MAITDFFAGEIATELLKQLFTISTTAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVGSMKIGGGGLISEAMKRAEAMEIETNDDSEKFGVGLELGKVKVKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIELHDIDEGNAFAILVDLSHKNLLTLGKDPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLLMPKRELDLPGDWERNNDEHYIAQIVSIHTGEMNEMQWFDMEFPKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHVICDTDVAFMWEEVEKAVPGLKIEAAEKCFSLDWLDE

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MAITDFFAGEIATELLKQLFTISTTAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVG

HMMPfam: PF05659
IPR008808
15-132 RPW8
Powdery mildew resistance protein, RPW8 domain

LLKQLFTISTTAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSV

HMMPanther: PTHR23155:SF282
25-794 PTHR23155:SF282,SUBFAMILY NOT NAMED

TAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVGSMKIGGGGLISEAMKRAEAMEIETNDDSEKFGVGLELGKVKVKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIELHDIDEGNAFAILVDLSHKNLLTLGKDPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLLMPKRELDLPGDWERNNDEHYIAQIVSIHTGEMNEMQWFDMEFPKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHVICDTDVAFMWEEVE

HMMPanther: PTHR23155
25-794 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVGSMKIGGGGLISEAMKRAEAMEIETNDDSEKFGVGLELGKVKVKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIELHDIDEGNAFAILVDLSHKNLLTLGKDPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLLMPKRELDLPGDWERNNDEHYIAQIVSIHTGEMNEMQWFDMEFPKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHVICDTDVAFMWEEVE

HMMPfam: PF00931
IPR002182
191-443 NB-ARC,NBS
NB-ARC

VKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIE

Gene3D: G3DSA:3.40.50.300
198-230 G3DSA:3.40.50.300

SQGGVFGISGMGGVGKTTLAKELQRDHEVQCHF

superfamily: SSF52540
198-387 SSF52540

SQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRL

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

VFGISGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

PFDGARKLVILDDVW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CKGLPLALKVTGASL

superfamily: SSF52047
554-780 SSF52047,LRR

PKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHV

Gene3D: G3DSA:3.80.10.10
561-780 G3DSA:3.80.10.10

LNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHV

FPrintScan: PR00364
IPR000767
725-741 DISEASERSIST
Disease resistance protein

CELPGLKYLDISQCVSL

HMMPfam: PF00560
IPR001611
730-751 LRR_1
Leucine-rich repeat

LKYLDISQCVSLSCLPEEIGKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox