PRGDB00049552 (ADR1)

From PRG Wiki
Jump to: navigation, search
ADR1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 42562493 (NM_103079)
Gene Class RPW8-NL
Domain Type LRR, NBS, Ser-Thr Kinase, Ser-Thr Kinase, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ADR1 (ACTIVATED DISEASE RESISTANCE 1) (ADR1) mRNA, complete cds.

DNA Sequence

ATGGCTTCGTTCATAGATCTTTTCGCCGGCGACATCACGACGCAACTCTTAAAGCTGCTCGCTCTAGTAGCTAACACAGTCTACAGTTGCAAAGGAATCGCCGAACGACTGATCACGATGATCAGAGACGTTCAACCAACGATCAGGGAGATCCAATACAGTGGCGCGGAGCTGAGTAACCATCACCAAACTCAACTGGGAGTATTCTATGAGATCTTGGAGAAAGCAAGAAAGCTATGTGAAAAGGTTTTAAGATGCAATAGGTGGAACCTTAAACATGTGTACCACGCGAATAAGATGAAGGATCTCGAGAAACAAATATCTCGTTTCCTCAACAGCCAGATTTTGCTCTTTGTTCTTGCTGAGGTATGTCATCTACGGGTCAATGGTGACAGGATTGAGAGGAATATGGATAGACTGTTGACTGAGCGGAATGATTCTTTGTCGTTTCCGGAGACTATGATGGAGATTGAGACGGTAAGCGATCCGGAGATTCAGACGGTATTGGAATTGGGGAAGAAAAAGGTGAAGGAGATGATGTTTAAGTTTACGGATACACATTTGTTTGGGATCTCTGGAATGAGCGGTTCAGGGAAAACCACTCTTGCAATAGAGCTTTCAAAGGACGATGATGTTCGAGGACTCTTTAAGAATAAGGTTTTGTTTTTGACTGTGTCACGGTCTCCGAATTTTGAGAATTTGGAGTCTTGTATACGAGAATTTCTTTATGATGGAGTTCATCAACGGAAGCTAGTGATTCTTGATGATGTTTGGACAAGGGAGTCCTTGGACAGGCTGATGTCTAAAATTCGTGGAAGCACTACTTTAGTAGTGTCACGGTCCAAGCTTGCAGATCCTAGAACCACCTACAATGTGGAATTATTAAAGAAAGATGAAGCAATGTCTCTTTTGTGTCTCTGTGCTTTCGAACAAAAGTCCCCGCCTTCTCCATTCAACAAATATTTGGTGAAGCAGGTTGTTGATGAGTGTAAAGGTTTACCTTTATCTTTGAAAGTTCTTGGTGCTTCGTTAAAAAACAAACCTGAAAGATATTGGGAAGGCGTAGTGAAGAGGTTATTAAGAGGAGAAGCTGCTGATGAAACTCATGAGAGCAGAGTGTTTGCTCATATGGAAGAAAGTCTAGAAAACCTCGACCCGAAAATCCGAGACTGTTTCTTGGATATGGGTGCTTTCCCTGAAGACAAGAAGATCCCTCTTGATCTTCTCACGAGCGTGTGGGTTGAGAGGCATGATATTGACGAGGAAACTGCGTTTTCCTTTGTTCTTCGTTTAGCTGACAAGAATCTCCTTACTATAGTGAACAATCCGAGGTTTGGCGATGTGCACATTGGCTACTATGATGTATTTGTGACGCAACACGATGTTTTGAGAGACCTAGCCCTTCATATGTCCAATCGTGTGGACGTAAATAGGAGAGAGCGGTTATTAATGCCAAAAACAGAGCCAGTGCTTCCAAGAGAATGGGAAAAGAATAAAGATGAGCCATTTGATGCCAAGATAGTTTCCCTTCATACAGGGGAAATGGATGAAATGAATTGGTTTGACATGGACCTCCCTAAGGCAGAAGTTTTAATACTGAACTTCTCTTCGGACAACTACGTCTTGCCACCATTTATTGGTAAGATGAGTAGACTCAGGGTGCTCGTGATTATCAACAATGGCATGTCTCCTGCGCGTCTACATGGCTTCTCCATCTTTGCCAATTTGGCCAAACTGAGGAGTCTCTGGCTCAAGAGGGTACATGTCCCTGAACTCACCAGCTGCACCATTCCACTGAAAAACCTGCACAAGATACATCTAATCTTTTGTAAGGTCAAGAACAGCTTTGTTCAGACGTCATTCGACATCTCGAAAATATTCCCAAGCTTGTCTGATCTCACTATTGATCACTGTGATGATCTTTTGGAACTAAAATCCATATTTGGAATAACCTCTCTCAACTCTCTCAGCATAACCAACTGTCCACGGATTCTTGAATTGCCCAAGAATTTGAGTAACGTACAGTCCCTTGAACGTCTAAGGTTATATGCCTGCCCCGAGCTGATATCCCTCCCGGTCGAAGTTTGTGAGCTGCCATGTCTAAAGTACGTTGACATTTCACAGTGTGTCAGCCTGGTTTCTCTTCCTGAAAAGTTTGGAAAGCTAGGGAGTCTTGAGAAAATTGACATGAGAGAATGCAGTTTATTGGGTTTACCAAGTTCTGTAGCTGCACTTGTGTCTCTACGCCATGTCATTTGCGATGAGGAGACTTCGTCTATGTGGGAAATGGTCAAGAAGGTGGTTCCTGAACTTTGCATTGAAGTCGCCAAAAAATGCTTCACCGTGGATTGGCTTGACGATTAG


Protein sequences

Name Description Sequence
ADR1 (ACTIVATED DISEASE RESISTANCE 1) ADR1 (ACTIVATED DISEASE RESISTANCE 1) [Arabidopsis thaliana].

MASFIDLFAGDITTQLLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRVNGDRIERNMDRLLTERNDSLSFPETMMEIETVSDPEIQTVLELGKKKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSKDDDVRGLFKNKVLFLTVSRSPNFENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLRGEAADETHESRVFAHMEESLENLDPKIRDCFLDMGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHVICDEETSSMWEMVKKVVPELCIEVAKKCFTVDWLDD

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MASFIDLFAGDITTQLLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRVNGDRIERNMDRLLTERNDSLS

HMMPfam: PF05659
IPR008808
16-128 RPW8
Powdery mildew resistance protein, RPW8 domain

LLKLLALVANTVYSCKGIAERLITMIRDVQPTIREIQYSGAELSNHHQTQLGVFYEILEKARKLCEKVLRCNRWNLKHVYHANKMKDLEKQISRFLNSQILLFVLAEVCHLRV

superfamily: SSF52540
164-361 SSF52540

EIQTVLELGKKKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSKDDDVRGLFKNKVLFLTVSRSPNFENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLR

Gene3D: G3DSA:3.40.50.300
174-208 G3DSA:3.40.50.300

KKVKEMMFKFTDTHLFGISGMSGSGKTTLAIELSK

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

LFGISGMSGSGKTTLA

HMMPfam: PF00931
IPR002182
232-416 NB-ARC,NBS
NB-ARC

ENLESCIREFLYDGVHQRKLVILDDVWTRESLDRLMSKIRGSTTLVVSRSKLADPRTTYNVELLKKDEAMSLLCLCAFEQKSPPSPFNKYLVKQVVDECKGLPLSLKVLGASLKNKPERYWEGVVKRLLRGEAADETHESRVFAHMEESLENLDPKIRDCFLDMGAFPEDKKIPLDLLTSVWVER

FPrintScan: PR00364
IPR000767
330-344 DISEASERSIST
Disease resistance protein

CKGLPLSLKVLGASL

HMMPanther: PTHR24420:SF764
395-739 PTHR24420:SF764

MGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

HMMPanther: PTHR24420
395-739 PTHR24420,FAMILY NOT NAMED

MGAFPEDKKIPLDLLTSVWVERHDIDEETAFSFVLRLADKNLLTIVNNPRFGDVHIGYYDVFVTQHDVLRDLALHMSNRVDVNRRERLLMPKTEPVLPREWEKNKDEPFDAKIVSLHTGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLP

superfamily: SSF52058
501-755 SSF52058,LRR

EPFDAKIVSLHTGEMDEMNWFDMDLPKAEVLILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHVICDE

Gene3D: G3DSA:3.80.10.10
531-751 G3DSA:3.80.10.10

LILNFSSDNYVLPPFIGKMSRLRVLVIINNGMSPARLHGFSIFANLAKLRSLWLKRVHVPELTSCTIPLKNLHKIHLIFCKVKNSFVQTSFDISKIFPSLSDLTIDHCDDLLELKSIFGITSLNSLSITNCPRILELPKNLSNVQSLERLRLYACPELISLPVEVCELPCLKYVDISQCVSLVSLPEKFGKLGSLEKIDMRECSLLGLPSSVAALVSLRHV

FPrintScan: PR00364
IPR000767
720-736 DISEASERSIST
Disease resistance protein

GKLGSLEKIDMRECSLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox