PRGDB00049555 (disease resistance protein-related)

From PRG Wiki
Jump to: navigation, search
disease resistance protein-related
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30683854 (NM_117791)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein-related (AT4G16880) mRNA, complete cds.

DNA Sequence

ATGGTGTTCAACACACGAGAGATCCAAATTTCTTTGAGTGATAGTGAGAGATTCCGCAAGAAACAAGTTAAAGGTTCAAACTTTCTCCACACTTGTCTTTTGAAACACACATATCTCTCTACGTGTATGTTACCAAAGATTTCAAGTAACATCATATGCCTATGGTGGCGTTATTGTCCATTGAAGCGTTTGCCTTCTAATTTTAAGGCTGAGTATCTGGTTGAACTCATAATGGAGGATAGTGACCTTGAGAAGCTGTGGAATGGAACTCAGTTACTTGGAAGCCTAAAGAAGATGATTCTGCGTAATTCCAAATATTTGAAAGAAATTCCAGATCTTTCTTTAGCCACAAACCTCGAGAGACTAGATCTTTGTAAATGCGAAGTGCTAGAAAGTTTTCCAACTCCTCTCAACTCGGAATCTCTTGAGTACCTCAATCTCCTACGATGCCCCAAGTTGAGAAATTTCCCTGAGATTATTATGCACAGTTTCAGAGGAGAAATTGACATCGAGGTAGCAGATTGTTTATGGAACAAGAATCTCCCTGGACTCGGTTATCTTGATTGCCTTAGGAGATGTAATCCAAGTAAATTTCGCCCAGAACATCTCAAAGACCTCACAGTGAGATGTAACAACAAGCTTGAGAAGCTATGGGAAGGCGTCCAGGTAATTCATACGTATATTATATATTGA


Protein sequences

Name Description Sequence
disease resistance protein-related disease resistance protein-related [Arabidopsis thaliana].

MVFNTREIQISLSDSERFRKKQVKGSNFLHTCLLKHTYLSTCMLPKISSNIICLWWRYCPLKRLPSNFKAEYLVELIMEDSDLEKLWNGTQLLGSLKKMILRNSKYLKEIPDLSLATNLERLDLCKCEVLESFPTPLNSESLEYLNLLRCPKLRNFPEIIMHSFRGEIDIEVADCLWNKNLPGLGYLDCLRRCNPSKFRPEHLKDLTVRCNNKLEKLWEGVQVIHTYIIY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24790:SF20
1-230 DISEASE RESISTANCE PROTEIN-RELATED

MVFNTREIQISLSDSERFRKKQVKGSNFLHTCLLKHTYLSTCMLPKISSNIICLWWRYCPLKRLPSNFKAEYLVELIMEDSDLEKLWNGTQLLGSLKKMILRNSKYLKEIPDLSLATNLERLDLCKCEVLESFPTPLNSESLEYLNLLRCPKLRNFPEIIMHSFRGEIDIEVADCLWNKNLPGLGYLDCLRRCNPSKFRPEHLKDLTVRCNNKLEKLWEGVQVIHTYIIY

HMMPanther: PTHR24790
1-230 FAMILY NOT NAMED,FAMILY NOT NAMED

MVFNTREIQISLSDSERFRKKQVKGSNFLHTCLLKHTYLSTCMLPKISSNIICLWWRYCPLKRLPSNFKAEYLVELIMEDSDLEKLWNGTQLLGSLKKMILRNSKYLKEIPDLSLATNLERLDLCKCEVLESFPTPLNSESLEYLNLLRCPKLRNFPEIIMHSFRGEIDIEVADCLWNKNLPGLGYLDCLRRCNPSKFRPEHLKDLTVRCNNKLEKLWEGVQVIHTYIIY

Gene3D: G3DSA:3.80.10.10
9-162 no description

QISLSDSERFRKKQVKGSNFLHTCLLKHTYLSTCMLPKISSNIICLWWRYCPLKRLPSNFKAEYLVELIMEDSDLEKLWNGTQLLGSLKKMILRNSKYLKEIPDLSLATNLERLDLCKCEVLESFPTPLNSESLEYLNLLRCPKLRNFPEIIMH

superfamily: SSF52058
19-162 L domain-like,LRR

RKKQVKGSNFLHTCLLKHTYLSTCMLPKISSNIICLWWRYCPLKRLPSNFKAEYLVELIMEDSDLEKLWNGTQLLGSLKKMILRNSKYLKEIPDLSLATNLERLDLCKCEVLESFPTPLNSESLEYLNLLRCPKLRNFPEIIMH

HMMPfam: PF07725
IPR011713
72-91 LRR_3
Leucine-rich repeat 3

YLVELIMEDSDLEKLWNGTQ

Seg: seg
137-148 seg

LNSESLEYLNLL

HMMPfam: PF07725
IPR011713
202-222 LRR_3
Leucine-rich repeat 3

HLKDLTVRCNNKLEKLWEGVQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox