PRGDB00049556 (WRKY19)

From PRG Wiki
Jump to: navigation, search
WRKY19
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30681995 (NM_117272)
Gene Class TNL
Domain Type LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase, Receptor-Like Kinase, Receptor-Like Kinase, NBS, Ser-Thr Kinase, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana WRKY19 (WRKY DNA-binding protein 19); transcription factor (WRKY19) mRNA, complete cds.

DNA Sequence

ATGTCGGAGAAGGAAGAACTTCCGTTGACATTGACGTCCATCGGAGCGGCCACCGCGACTAGTGATTATCATCAGAGAGTAGGAAGTTCCGGTGAAGGGATTAGTAGCTCGAGTAGTGATGTTGACCCGAGGTTCATGCAGAATAGCCCCACGGGTTTGATGATTTCCCAATCGTCGTCGATGTGCACCGTACCGCCTGGCATGGCAGCAACACCACCAATAAGCTCAGGTTCCGGTTTATCTCAGCAGCTTAATAATTCTTCTAGTTCCAAGTTATGTCAAGTGGAAGGATGTCAAAAAGGAGCAAGAGATGCATCTGGTCGTTGCATTTCCCATGGCGGTGGACGTAGATGCCAGAAACCTGATTGCCAGAAGGGAGCTGAAGGTAAAACAGTGTACTGTAAAGCCCACGGAGGTGGTCGCAGATGTGAATATCTTGGATGCACCAAAGGCGCAGAAGGCAGTACTGATTTTTGTATAGCTCATGGAGGTGGTCGAAGATGCAACCATGAAGATTGCACACGATCTGCTTGGGGAAGAACAGAATTCTGTGTCAAGCACGGTGGAGGAGCGAGATGCAAAACATACGGCTGCGGAAAAAGCGCTAGTGGTCCTTTGCCATTCTGCCGAGCCCATGGTGGTGGTAAAAAATGCAGCCATGAAGATTGCACAGGATTTGCTAGGGGAAGATCAGGACTCTGTCTCATGCACGGTGGGGGAAAGAGATGCCAAAGAGAGAACTGCACTAAAAGCGCTGAAGGTCTTTCGGGACTCTGCATATCCCATGGTGGTGGTCGGCGATGTCAATCTATTGGATGCACAAAAGGAGCGAAAGGGAGCAAAATGTTCTGCAAAGCATGCATAACTAAAAGGCCTCTAACGATTGATGGAGGAGGAAATATGGGAGGGGTAACAACAGGTGATGCCTTGAACTATCTCAAAGCTGTGAAGGACAAGTTTGAAGACAGTGAGAAATATGACACTTTCCTTGAAGTCTTGAATGACTGTAAACATCAGGGAGTTGACACTAGTGGCGTCATAGCCAGATTAAAAGATTTGTTCAAGGGCCATGACGACTTACTTTTGGGTTTTAATACCTACTTGTCAAAGGAGTACCAAATAACCATTCTGCCCGAGGATGATTTCCCTATCGATTTTCTTGACAAGGTTGAGGGACCTTATGAAATGACATATCAGCAAGCTCAAACAGTTCAAGCCAATGCCAATATGCAACCTCAAACTGAGTACCCTTCTTCCTCTGCGGTTCAATCATTTTCATCGGGTCAACCTCAGATCCCCACCTCAGCTCCGGATTCTTCACTACTAGCTAAAAGTAATACCTCAGGTATAACTATCATCGAGCACATGTCACAACAGCCTCTAAATGTTGACAAACAAGTTAATGATGGCTATAACTGGCAAAAGTATGGGCAAAAGAAAGTTAAAGGCAGCAAGTTTCCTCTAAGCTATTACAAGTGCACATATCTAGGATGTCCTTCCAAGAGGAAGGTTGAGAGATCTCTTGATGGACAAGTAGCAGAAATCGTCTACAAAGATCGACACAATCACGAACCTCCTAACCAAGGAAAAGATGGTAGCACCACATATCTAAGTGGGAGTTCGACACACATCAATTGCATGAGCTCTGAATTGACAGCATCACAGTTTAGCTCCAACAAGACTAAGATAGAGCAACAGGAAGCAGCAAGTCTAGCTACGACAATAGAGTACATGTCTGAGGCAAGTGACAATGAAGAAGACAGTAATGGAGAAACTAGTGAGGGAGAGAAAGATGAAGACGAGCCTGAACCAAAGAGAAGAATTACAGAAGTTCAGGTTTCGGAACTAGCTGATGCTTCAGATAGAACCGTGAGAGAGCCTAGGGTTATTTTCCAAACAACGAGTGAAGTTGATAATTTAGATGATGGATATAGGTGGCGGAAATATGGACAGAAAGTTGTTAAAGGGAATCCTTATCCAAGGTTTTCCTCCTCTAAAGATTATGATGTCGTAATCAGATACGGAAGAGCAGATATAAGCAATGAGGATTTCATTAGCCATCTTCGTGCTTCCCTCTGCCGGAGAGGGATTTCTGTCTATGAAAAATTTAATGAAGTGGATGCACTTCCAAAATGTAGGGTTTTGATTATAGTATTAACAAGCACATATGTCCCTTCGAACCTCTTAAACATTCTTGAACACCAACATACAGAGGATCGAGTGGTTTATCCAATTTTCTACAGACTATCACCATATGATTTTGTCTGTAACAGCAAGAATTATGAGAGATTTTATCTCCAAGATGAGCCAAAAAAATGGCAAGCTGCTTTGAAGGAAATAACTCAGATGCCTGGCTACACATTGACAGATAAGTCTGAATCTGAACTTATAGATGAGATTGTAAGAGATGCTTTAAAGGTGCTATGTTCTGCTGATAAGGTGAACATGATTGGGATGGATATGCAAGTAGAGGAGATTTTGTCACTGCTATGCATTGAGTCCCTTGATGTTCGCAGCATTGGTATATGGGGTACAGTTGGTATAGGAAAAACAACCATTGCTGAAGAGATCTTTCGCAAAATCTCTGTCCAATATGAGACCTGTGTCGTCCTTAAGGACCTCCACAAAGAAGTTGAGGTAAAAGGTCACGATGCTGTGAGAGAGAATTTTCTGTCTGAAGTTTTAGAGGTAGAACCTCATGTTATCCGGATATCTGACATTAAAACAAGCTTCTTGAGAAGTCGGCTTCAGCGTAAAAGGATCCTTGTTATTCTTGACGATGTGAATGATTACAGAGATGTTGACACCTTTTTGGGGACGCTTAACTATTTTGGTCCAGGAAGCAGAATAATCATGACCTCTAGAAATAGACGTGTTTTCGTACTATGTAAAATCGATCATGTCTATGAGGTTAAGCCATTAGATATTCCTAAGTCTCTACTACTTCTTGATCGTGGGACATGTCAAATTGTTTTGTCACCTGAGGTTTACAAGACATTGTCACTTGAGCTGGTCAAATTTTCAAATGGAAATCCCCAGGTTCTTCAGTTCTTGAGCAGTATTGACAGAGAATGGAATAAGTTATCACAAGAAGTTAAGACAACATCTCCCATTTACATCCCAGGTATATTTGAAAAGAGCTGTTGTGGGCTTGATGACAACGAGAGGGGTATATTTTTGGACATTGCATGTTTCTTTAATAGGATTGATAAAGACAATGTCGCAATGTTGCTGGATGGTTGTGGTTTCTCTGCACATGTCGGATTTAGAGGCCTTGTTGACAAATCACTGTTGACAATATCACAACACAACTTGGTGGACATGCTCAGTTTTATCCAGGCAACTGGTCGAGAAATTGTTCGCCAAGAATCAGCTGACAGACCAGGAGACCGCAGCAGGTTGTGGAATGCCGACTATATCAGACACGTATTCATAAATGACACTGGCACATCAGCTATTGAGGGCATTTTCCTAGACATGTTGAATCTTAAATTTGATGCAAATCCCAACGTGTTCGAGAAAATGTGTAACCTTAGACTGTTGAAATTGTATTGCTCCAAAGCGGAAGAGAAGCATGGAGTATCTTTTCCACAAGGTCTTGAATATTTGCCGAGCAAGCTAAGGCTTCTCCATTGGGAATATTATCCTCTAAGTTCTTTGCCGAAAAGTTTTAATCCAGAGAACCTTGTCGAGCTTAACTTGCCAAGTAGCTGTGCAAAGAAACTTTGGAAAGGAAAAAAGGCAAGGTTTTGTACAACCAATTCAAGTCTGGAAAAGCTTAAAAAGATGAGACTTAGCTACTCCGACCAGTTAACTAAAATCCCAAGACTTTCAAGCGCAACAAATCTTGAGCATATTGATCTTGAAGGTTGCAACAGTTTGTTGAGCCTTAGCCAGTCCATTTCTTATCTTAAGAAGCTTGTTTTTCTGAATTTAAAGGGCTGCTCGAAGCTGGAGAATATTCCATCTATGGTTGATTTAGAATCGCTTGAGGTTCTAAATCTTTCGGGTTGTTCAAAGCTAGGGAACTTCCCGGAGATCTCACCAAATGTGAAAGAACTGTACATGGGTGGGACTATGATACAAGAAATCCCGTCATCGATTAAGAACTTGGTATTGCTTGAGAAACTGGACCTGGAAAACAGTAGACATCTCAAGAATCTTCCAACAAGCATCTACAAGTTGAAGCATCTTGAAACTCTAAATCTTTCAGGCTGCATAAGCCTGGAGCGATTTCCAGACTCGTCGAGAAGGATGAAATGCTTAAGGTTTTTGGATTTAAGCAGGACAGACATTAAAGAGCTGCCCTCTTCCATATCGTATCTGACTGCTCTTGACGAACTATTATTCGTAGACTCCAGGAGAAACTCGCCAGTTGTAACCAATCCCAATGCCAATTCAACTGAGTTGATGCCTTCTGAGTCAAGTAAGCTTGAGATCTTAGGTACTCCGGCAGATAACGAAGTAGTTGTTGGTGGTACGGTAGAGAAAACCCGTGGTATTGAACGAACGCCGACTATTTTGGTGAAGTCGAGAGAGTATCTAATTCCCGATGATGTTGTGGCGGTTGGTGGTGATATTAAGGGGCTAAGACCACCAGTACTTCAGCTCCAACCAGCAATGAAACTATCTCATATTCCTCGAGGATCAACTTGGGATTTCGTTACGCATTTCGCTCCACCTGAAACAGTTGCGCCGCCGAGTTCCTCTTCAGAAGCCAGGGAAGAGGAAGTGGAAACGGAAGAGACGGGAGCTATGTTTATCCCATTGGGGGATAAGGAGACATGCTCATTCACTGTAAACAAGGGTGACTCCTCAAGGACAATATCTAATACGTCGCCGATTTATGCCTCCGAAGGATCTTTCATCACGTGTTGGCAGAAGGGTCAACTTCTGGGACGAGGATCATTAGGGTCCGTATATGAAGGCATTTCAGCAGACGGGGACTTCTTTGCTTTCAAGGAAGTTTCACTACTTGATCAGGGAAGTCAGGCACATGAATGGATACAACAAGTCGAGGGGGGGATTGCGCTACTTAGTCAGCTTCAGCATCAGAATATCGTGCGATATCGTGGCACAACTAAGGACGAGTCGAATTTGTACATTTTTCTTGAACTTGTAACCCAAGGGTCCCTTCGAAAACTCTACCAAAGAAACCAGCTTGGGGACTCTGTAGTCTCCTTATACACAAGACAGATTCTTGATGGATTGAAATATCTCCACGATAAAGGTTTTATACACAGGAACATTAAATGTGCAAATGTATTGGTGGACGCTAATGGAACAGTTAAACTTGCAGATTTTGGATTGGCTAAGGTAATGTCCCTCTGGCGAACTCCGTATTGGAATTGGATGGCTCCAGAGGTTATTGTTTTAAAATCCTTCCCGCTGTTTTAA


Protein sequences

Name Description Sequence
WRKY19 (WRKY DNA-binding protein 19); transcription factor WRKY19 (WRKY DNA-binding protein 19); transcription factor [Arabidopsis thaliana].

MSEKEELPLTLTSIGAATATSDYHQRVGSSGEGISSSSSDVDPRFMQNSPTGLMISQSSSMCTVPPGMAATPPISSGSGLSQQLNNSSSSKLCQVEGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGSTDFCIAHGGGRRCNHEDCTRSAWGRTEFCVKHGGGARCKTYGCGKSASGPLPFCRAHGGGKKCSHEDCTGFARGRSGLCLMHGGGKRCQRENCTKSAEGLSGLCISHGGGRRCQSIGCTKGAKGSKMFCKACITKRPLTIDGGGNMGGVTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKEYQITILPEDDFPIDFLDKVEGPYEMTYQQAQTVQANANMQPQTEYPSSSAVQSFSSGQPQIPTSAPDSSLLAKSNTSGITIIEHMSQQPLNVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPPNQGKDGSTTYLSGSSTHINCMSSELTASQFSSNKTKIEQQEAASLATTIEYMSEASDNEEDSNGETSEGEKDEDEPEPKRRITEVQVSELADASDRTVREPRVIFQTTSEVDNLDDGYRWRKYGQKVVKGNPYPRFSSSKDYDVVIRYGRADISNEDFISHLRASLCRRGISVYEKFNEVDALPKCRVLIIVLTSTYVPSNLLNILEHQHTEDRVVYPIFYRLSPYDFVCNSKNYERFYLQDEPKKWQAALKEITQMPGYTLTDKSESELIDEIVRDALKVLCSADKVNMIGMDMQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSIDREWNKLSQEVKTTSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLKFDANPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDELLFVDSRRNSPVVTNPNANSTELMPSESSKLEILGTPADNEVVVGGTVEKTRGIERTPTILVKSREYLIPDDVVAVGGDIKGLRPPVLQLQPAMKLSHIPRGSTWDFVTHFAPPETVAPPSSSSEAREEEVETEETGAMFIPLGDKETCSFTVNKGDSSRTISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVIVLKSFPLF

Domains

Domain Start-End Description Sequence

HMMSmart: SM00181
IPR006210
92-135 EGF
Epidermal growth factor-like

LCQVEGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCK

ProfileScan: PS51477
IPR003822
291-371 PAH,PAH domain profile.
Paired amphipathic helix

RPLTIDGGGNMGGVTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKE

superfamily: SSF47762
IPR003822
297-371 PAH
Paired amphipathic helix

GGGNMGGVTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKE

Gene3D: G3DSA:1.20.1160.11
IPR003822
304-372 PAH
Paired amphipathic helix

VTTGDALNYLKAVKDKFEDSEKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYLSKEY

HMMPfam: PF02671
IPR003822
324-368 PAH
Paired amphipathic helix

EKYDTFLEVLNDCKHQGVDTSGVIARLKDLFKGHDDLLLGFNTYL

superfamily: SSF118290
IPR003657
458-527 SSF118290
DNA-binding WRKY

QQPLNVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPPN

Gene3D: G3DSA:2.20.25.80
IPR003657
462-526 WRKY_DNA-bd
DNA-binding WRKY

NVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPP

ProfileScan: PS50811
IPR003657
462-526 WRKY
DNA-binding WRKY

NVDKQVNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEPP

HMMPfam: PF03106
IPR003657
467-524 WRKY
DNA-binding WRKY

VNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHE

HMMSmart: SM00774
IPR003657
467-525 WRKY
DNA-binding WRKY

VNDGYNWQKYGQKKVKGSKFPLSYYKCTYLGCPSKRKVERSLDGQVAEIVYKDRHNHEP

Gene3D: G3DSA:2.20.25.80
IPR003657
625-662 WRKY_DNA-bd
DNA-binding WRKY

REPRVIFQTTSEVDNLDDGYRWRKYGQKVVKGNPYPRF

superfamily: SSF118290
IPR003657
631-661 SSF118290
DNA-binding WRKY

FQTTSEVDNLDDGYRWRKYGQKVVKGNPYPR

ProfileScan: PS50811
IPR003657
635-661 WRKY
DNA-binding WRKY

SEVDNLDDGYRWRKYGQKVVKGNPYPR

HMMPfam: PF03106
IPR003657
640-661 WRKY
DNA-binding WRKY

LDDGYRWRKYGQKVVKGNPYPR

HMMSmart: SM00774
IPR003657
640-689 WRKY
DNA-binding WRKY

LDDGYRWRKYGQKVVKGNPYPRFSSSKDYDVVIRYGRADISNEDFISHLR

superfamily: SSF52200
IPR000157
656-786 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GNPYPRFSSSKDYDVVIRYGRADISNEDFISHLRASLCRRGISVYEKFNEVDALPKCRVLIIVLTSTYVPSNLLNILEHQHTEDRVVYPIFYRLSPYDFVCNSKNYERFYLQDEPKKWQAALKEITQMPGY

HMMPanther: PTHR11017
665-1448 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SKDYDVVIRYGRADISNEDFISHLRASLCRRGISVYEKFNEVDALPKCRVLIIVLTSTYVPSNLLNILEHQHTEDRVVYPIFYRLSPYDFVCNSKNYERFYLQDEPKKWQAALKEITQMPGYTLTDKSESELIDEIVRDALKVLCSADKVNMIGMDMQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSIDREWNKLSQEVKTTSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLKFDANPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDEL

HMMPanther: PTHR11017:SF20
665-1448 PTHR11017:SF20,SUBFAMILY NOT NAMED

SKDYDVVIRYGRADISNEDFISHLRASLCRRGISVYEKFNEVDALPKCRVLIIVLTSTYVPSNLLNILEHQHTEDRVVYPIFYRLSPYDFVCNSKNYERFYLQDEPKKWQAALKEITQMPGYTLTDKSESELIDEIVRDALKVLCSADKVNMIGMDMQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSIDREWNKLSQEVKTTSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQATGREIVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLKFDANPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDEL

superfamily: SSF52540
815-1021 SSF52540

NMIGMDMQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSI

HMMPfam: PF00931
IPR002182
821-1083 NB-ARC,NBS
NB-ARC

MQVEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEVYKTLSLELVKFSNGNPQVLQFLSSIDREWNKLSQEVKTTSPIYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGF

Gene3D: G3DSA:3.40.50.300
823-956 G3DSA:3.40.50.300

VEEILSLLCIESLDVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRN

HMMSmart: SM00382
IPR003593
836-996 AAA,NBS
AAA+ ATPase domain

DVRSIGIWGTVGIGKTTIAEEIFRKISVQYETCVVLKDLHKEVEVKGHDAVRENFLSEVLEVEPHVIRISDIKTSFLRSRLQRKRILVILDDVNDYRDVDTFLGTLNYFGPGSRIIMTSRNRRVFVLCKIDHVYEVKPLDIPKSLLLLDRGTCQIVLSPEV

FPrintScan: PR00364
IPR000767
839-854 DISEASERSIST
Disease resistance protein

SIGIWGTVGIGKTTIA

FPrintScan: PR00364
IPR000767
915-929 DISEASERSIST
Disease resistance protein

RLQRKRILVILDDVN

superfamily: SSF46785
1038-1145 SSF46785

IYIPGIFEKSCCGLDDNERGIFLDIACFFNRIDKDNVAMLLDGCGFSAHVGFRGLVDKSLLTISQHNLVDMLSFIQATGREIVRQESADRPGDRSRLWNADYIRHVFI

superfamily: SSF52058
1119-1446 SSF52058,LRR

IVRQESADRPGDRSRLWNADYIRHVFINDTGTSAIEGIFLDMLNLKFDANPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALD

Gene3D: G3DSA:3.80.10.10
1168-1448 G3DSA:3.80.10.10

NPNVFEKMCNLRLLKLYCSKAEEKHGVSFPQGLEYLPSKLRLLHWEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQLTKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLEVLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKELPSSISYLTALDEL

HMMPfam: PF07725
IPR011713
1228-1247 LRR_3
Leucine-rich repeat 3

NLVELNLPSSCAKKLWKGKK

FPrintScan: PR00364
IPR000767
1325-1341 DISEASERSIST
Disease resistance protein

VDLESLEVLNLSGCSKL

HMMPfam: PF00560
IPR001611
1329-1346 LRR_1
Leucine-rich repeat

SLEVLNLSGCSKLGNFPE

HMMPfam: PF00560
IPR001611
1397-1415 LRR_1
Leucine-rich repeat

HLETLNLSGCISLERFPDS

Gene3D: G3DSA:3.30.200.20
1591-1734 G3DSA:3.30.200.20

GDKETCSFTVNKGDSSRTISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQIL

superfamily: SSF56112
IPR011009
1612-1790 Kinase_like
Protein kinase-like domain

TSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVI

ProfileScan: PS50011
IPR000719
1626-1798 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVIVLKSFPLF

HMMPfam: PF00069
IPR000719
1626-1790 Pkinase,Ser-thr
Protein kinase, catalytic domain

WQKGQLLGRGSLGSVYEGISADGDFFAFKEVSLLDQGSQAHEWIQQVEGGIALLSQLQHQNIVRYRGTTKDESNLYIFLELVTQGSLRKLYQRNQLGDSVVSLYTRQILDGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVI

Gene3D: G3DSA:1.10.510.10
1735-1790 G3DSA:1.10.510.10

DGLKYLHDKGFIHRNIKCANVLVDANGTVKLADFGLAKVMSLWRTPYWNWMAPEVI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox