PRGDB00049558 (LIM domain-containing protein / disease resistance protein-related)

From PRG Wiki
Jump to: navigation, search
LIM domain-containing protein / disease resistance protein-related
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186523757 (NM_121795)
Gene Class NL
Domain Type LRR, LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana LIM domain-containing protein / disease resistance protein-related (AT5G17890) mRNA, complete cds.

DNA Sequence

ATGGAACCACCAGCTGCTCGTGTAACGCCGTCGATTAAGGCCGACTGTAGTCACAGCGTCAACATCATCTGCGAGGAAACAGTACTGCACTCCCTTGTCAGCCACCTCTCGGCCGCTTTACGCCGGGAAGGCATATCTGTGTTTGTGGATGCGTGCGGATTGCAGGAAACCAAGTTCTTCTCCATTAAACAGAATCAGCCGTTGACAGATGGGGCTAGGGTTTTGGTGGTGGTTATTTCCGACGAGGTGGAGTTCTACGATCCTTGGTTTCCTAAGTTCTTAAAGGTTATCCAGGGTTGGCAAAACAACGGCCACGTGGTGGTTCCAGTCTTCTACGGCGTCGATTCGTTGACCCGAGTTTACGGGTGGGCCAATAGTTGGCTGGAGGCCGAAAAATTAACCAGCCACCAATCAAAGATCTTAAGCAATAATGTACTCACGGACTCCGAACTAGTGGAAGAGATCGTCAGAGATGTTTATGGGAAGCTTTATCCTGCAGAACGAGTTGGAATTTACGCGAGGCTACTAGAGATAGAAAAGTTGCTTTACAAGCAACATAGGGACATCCGAAGCATAGGAATTTGGGGTATGCCTGGCATAGGCAAGACGACGCTTGCTAAAGCAGTCTTTAATCACATGTCCACTGATTATGATGCTTCTTGCTTCATCGAGAACTTTGATGAAGCTTTTCATAAGGAGGGACTCCACCGTTTGCTCAAAGAAAGAATTGGTAAAATTCTAAAGGATGAGTTTGACATAGAAAGTTCGTATATTATGAGACCGACCCTCCATAGGGACAAATTATACGATAAAAGGATTCTTGTTGTTTTAGATGATGTGCGCGATTCCCTTGCTGCAGAGTCCTTCCTTAAAAGGCTTGATTGGTTTGGTTCCGGAAGCCTTATAATCATAACCTCCGTTGATAAACAAGTGTTTGCCTTTTGTCAGATCAATCAAATATACACGGTTCAAGGTTTAAATGTGCACGAGGCTCTGCAGCTTTTCTCCCAAAGCGTATTTGGAATAAACGAGCCAGAGCAGAATGACAGGAAACTGTCAATGAAGGTGATTGACTATGTTAATGGAAACCCGTTAGCTCTCAGCATTTACGGCCGAGAGCTAATGGGGAAGAAGTCAGAAATGGAGACTGCATTCTTCGAGCTCAAGCATTGTCCTCCCTTAAAGATTCAGGATGTGCTAAAAAACGCTTATAGTGCACTTAGCGACAATGAGAAGAACATTGTTTTGGACATTGCTTTTTTCTTCAAGGGAGAAACTGTCAATTATGTGATGCAGCTGCTTGAGGAATCTCATTACTTTCCACGTCTTGCAATAGATGTTCTTGTGGACAAGTGTGTGTTAACTATCTCAGAAAACACAGTGCAAATGAATAATTTGATCCAAGACACCTGCCAAGAAATCTTCAATGGAGAAATTGAGACCTGCACCAGAATGTGGGAACCTTCCAGAATCAGATATCTGCTAGAATATGATGAACTTGAAGGAAGTGGAGAAACCAAAGCAATGCCTAAATCTGGTCTGGTCGCTGAACACATCGAAAGCATATTCCTGGACACTTCAAACGTGAAATTTGATGTCAAACACGATGCATTCAAGAATATGTTTAATCTCAAATTCCTAAAGATATACAATTCATGCTCTAAATATATTTCTGGACTCAATTTTCCAAAGGGCCTCGATTCTCTGCCTTATGAGCTAAGGCTCCTCCACTGGGAGAACTACCCTTTGCAATCCTTGCCTCAAGATTTTGACTTTGGACACCTTGTTAAGCTCAGTATGCCTTACAGCCAGCTTCATAAACTCGGGACAAGAGTCAAGGACCTTGTGATGTTAAAGAGGCTCATTCTTTCTCATTCTTTACAGCTAGTTGAATGTGACATACTAATATATGCTCAAAATATCGAGCTAATTGATCTTCAAGGCTGTACAGGATTGCAAAGATTTCCAGACACGAGTCAATTACAGAATCTCCGGGTAGTAAATCTCTCAGGTTGCACAGAGATCAAATGTTTCTCAGGGGTTCCACCAAATATTGAGGAATTACATCTCCAAGGAACTCGTATAAGGGAAATACCAATATTCAATGCGACCCATCCCCCCAAGGTTAAGCTGGACCGGAAAAAGCTTTGGAATCTTCTAGAAAACTTCTCGGATGTTGAGCATATCGATTTGGAGTGTGTAACAAATCTAGCTACAGTTACCTCAAATAATCATGTTATGGGCAAGCTTGTCTGCTTGAATATGAAATATTGTTCCAATTTGCGAGGCCTTCCTGACATGGTCAGTTTAGAATCTCTCAAAGTTCTTTATCTGTCGGGCTGTTCAGAGCTTGAGAAAATTATGGGTTTCCCGAGAAACTTGAAAAAACTATATGTTGGTGGAACCGCCATACGAGAATTGCCACAGCTTCCCAACAGTCTAGAATTCCTGAATGCTCATGGTTGTAAGCATCTGAAGTCAATTAATTTGGATTTTGAGCAGCTTCCTAGGCACTTCATCTTCAGTAATTGTTATAGATTTTCTTCACAAGTGATCGCTGAGTTCGTAGAGAAAGGTCTTGTAGCAAGTTTAGCAAGAGCAAAACAAGAGGAACTCATCAAAGCACCTGAAGTCATCATCTGTATTCCTATGGACACACGGCAGAGATCCTCCTTTCGCTTGCAAGCAGGTCGAAATGCAATGACAGACTTAGTTCCGTGGATGCAAAAACCTATCTCAGGCTTTTCTATGTCAGTTGTAGTATCATTTCAAGATGATTACCACAATGATGTAGGTCTTCGCATTAGGTGTGTAGGTACATGGAAGACCTGGAACAACCAGCCTGATAGAATAGTTGAGAGATTTTTTCAATGTTGGGCTCCTACCGAAGCTCCAAAAGTTGTAGCGGATCACATTTTTGTCTTGTATGATACCAAAATGCATCCTAGTGATAGTGAAGAAAACCACATCAGTATGTGGGCTCATGAAGTCAAATTTGAATTCCACACAGTGAGTGGGGAAAACAATCCTCTAGGTGCTAGTTGCAAGGTGACTGAATGTGGTGTCGAGGTAATTACAGCTGCAACAGGTGATACTAGTGTTAGTGGAATTATAAGAGAAAGTGAAACTATAACTATTATCGAGAAGGAGGATACTATTATTGATGAGGAGGATACTCCTCTTTTGTCCAGAAAGCCAGAGGAAACGAATCGTTCTCGTTCATCTAGCGAATTACAGAAGCTTTCTAGTACGTCAAGTAAGGTAAGATCTAAGGGAAATGTGTTTTGGAAGTGGTTAGGTTGTTTTCCCCTGCAGCCAAAAAACTTGAGATCTAGAAGTAGGCGCACAACAGCGTTAGAAGAAGCGTTAGAAGAAGCATTAAAAGAAAGAGAAAAATTAGAGGACACCAGAGAGTTACAAATAGCATTAATAGAGTCAAAGAAGATAAAAAAAATAAAGCAAGCAGACGAAAGGGATCAAATAAAGCACGCAGACGAAAGGGAACAAAGAAAGCATTCCAAAGATCATGAGGAAGAAGAAATAGAGTCAAATGAGAAAGAAGAAAGAAGGCATTCCAAAGATTATGTGATAGAAGAATTAGTGTTAAAGGGGAAAGGTAAAAGAAAGCAACTGGATGATGATAAAGCCGACGAAAAGGAACAAATAAAGCATTCCAAAGATCATGTGGAAGAAGAAGTGAATCCTCCTCTTAGCAAATGCAAGGATTGCAAATCTGCAATTGAAGATGGAATATCTATCAATGCCTACGGTTCTGTTTGGCATCCTCAATGTTTCTGTTGCCTTCGTTGTCGGGAGCCTATTGCTATGAACGAGATTTCAGACTTAAGAGGAATGTATCACAAACCTTGCTACAAGGAGCTCCGTCATCCGAATTGCTATGTCTGCGAAAAAAAGATTCCTCGTACTGCGGAAGGTTTAAAGTACCATGAGCATCCGTTCTGGATGGAAACATACTGCCCTTCTCATGATGGTGATGGAACTCCCAAATGTTGTAGCTGTGAAAGATTAGAGCATTGCGGAACACAGTATGTAATGCTTGCAGATTTTCGATGGCTATGTCGAGAATGTATGGACAGCGCGATTATGGATTCTGATGAATGCCAACCTTTGCACTTTGAAATCCGTGAATTCTTTGAGGGCTTACACATGAAGATTGAGGAAGAATTTCCTGTTTATTTGGTGGAGAAAAATGCTCTGAATAAAGCTGAGAAGGAAGAGAAGATTGACAAACAGGGGGATCAGTGTCTGATGGTAGTCAGAGGTATTTGCCTATCTGAAGAGCAGATTGTCACAAGTGTCTCACAAGGAGTAAGGAGGATGTTGAATAAGCAGATACTAGATACGGTTACAGAGTCTCAAAGGGTTGTTCGCAAGTGCGAGGTCACTGCAATTCTCATCTTATATGGGCTTCCTAGGTTACTCACAGGATATATCTTGGCCCATGAGATGATGCATGCTTATCTTAGACTCAATGGTTACAGGAATCTTAACATGGTTCTTGAAGAAGGATTATGCCAAGTGTTAGGCTACATGTGGTTGGAGTGTCAGACATACGTTTTTGATACTGCCACAATAGCTTCTTCTTCTTCTTCTTCCCGCACTCCTCTATCTACAACCACATCAAAGAAAGTTGACCCATCTGATTTTGAGAAGAGGCTGGTAAATTTCTGCAAGCATCAGATAGAAACAGATGAGTCACCATTCTTCGGTGACGGGTTCAGGAAAGTTAACAAAATGATGGCCTCAAATAATCACAGCCTTAAGGATACCCTGAAAGAGATCATCAGCATTTCCAAGACTCCACAATATTCAAAGTTATGA


Protein sequences

Name Description Sequence
LIM domain-containing protein / disease resistance protein-related LIM domain-containing protein / disease resistance protein-related [Arabidopsis thaliana].

MEPPAARVTPSIKADCSHSVNIICEETVLHSLVSHLSAALRREGISVFVDACGLQETKFFSIKQNQPLTDGARVLVVVISDEVEFYDPWFPKFLKVIQGWQNNGHVVVPVFYGVDSLTRVYGWANSWLEAEKLTSHQSKILSNNVLTDSELVEEIVRDVYGKLYPAERVGIYARLLEIEKLLYKQHRDIRSIGIWGMPGIGKTTLAKAVFNHMSTDYDASCFIENFDEAFHKEGLHRLLKERIGKILKDEFDIESSYIMRPTLHRDKLYDKRILVVLDDVRDSLAAESFLKRLDWFGSGSLIIITSVDKQVFAFCQINQIYTVQGLNVHEALQLFSQSVFGINEPEQNDRKLSMKVIDYVNGNPLALSIYGRELMGKKSEMETAFFELKHCPPLKIQDVLKNAYSALSDNEKNIVLDIAFFFKGETVNYVMQLLEESHYFPRLAIDVLVDKCVLTISENTVQMNNLIQDTCQEIFNGEIETCTRMWEPSRIRYLLEYDELEGSGETKAMPKSGLVAEHIESIFLDTSNVKFDVKHDAFKNMFNLKFLKIYNSCSKYISGLNFPKGLDSLPYELRLLHWENYPLQSLPQDFDFGHLVKLSMPYSQLHKLGTRVKDLVMLKRLILSHSLQLVECDILIYAQNIELIDLQGCTGLQRFPDTSQLQNLRVVNLSGCTEIKCFSGVPPNIEELHLQGTRIREIPIFNATHPPKVKLDRKKLWNLLENFSDVEHIDLECVTNLATVTSNNHVMGKLVCLNMKYCSNLRGLPDMVSLESLKVLYLSGCSELEKIMGFPRNLKKLYVGGTAIRELPQLPNSLEFLNAHGCKHLKSINLDFEQLPRHFIFSNCYRFSSQVIAEFVEKGLVASLARAKQEELIKAPEVIICIPMDTRQRSSFRLQAGRNAMTDLVPWMQKPISGFSMSVVVSFQDDYHNDVGLRIRCVGTWKTWNNQPDRIVERFFQCWAPTEAPKVVADHIFVLYDTKMHPSDSEENHISMWAHEVKFEFHTVSGENNPLGASCKVTECGVEVITAATGDTSVSGIIRESETITIIEKEDTIIDEEDTPLLSRKPEETNRSRSSSELQKLSSTSSKVRSKGNVFWKWLGCFPLQPKNLRSRSRRTTALEEALEEALKEREKLEDTRELQIALIESKKIKKIKQADERDQIKHADEREQRKHSKDHEEEEIESNEKEERRHSKDYVIEELVLKGKGKRKQLDDDKADEKEQIKHSKDHVEEEVNPPLSKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPCYKELRHPNCYVCEKKIPRTAEGLKYHEHPFWMETYCPSHDGDGTPKCCSCERLEHCGTQYVMLADFRWLCRECMDSAIMDSDECQPLHFEIREFFEGLHMKIEEEFPVYLVEKNALNKAEKEEKIDKQGDQCLMVVRGICLSEEQIVTSVSQGVRRMLNKQILDTVTESQRVVRKCEVTAILILYGLPRLLTGYILAHEMMHAYLRLNGYRNLNMVLEEGLCQVLGYMWLECQTYVFDTATIASSSSSSRTPLSTTTSKKVDPSDFEKRLVNFCKHQIETDESPFFGDGFRKVNKMMASNNHSLKDTLKEIISISKTPQYSKL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24209:SF104
2-1611 PTHR24209:SF104

EPPAARVTPSIKADCSHSVNIICEETVLHSLVSHLSAALRREGISVFVDACGLQETKFFSIKQNQPLTDGARVLVVVISDEVEFYDPWFPKFLKVIQGWQNNGHVVVPVFYGVDSLTRVYGWANSWLEAEKLTSHQSKILSNNVLTDSELVEEIVRDVYGKLYPAERVGIYARLLEIEKLLYKQHRDIRSIGIWGMPGIGKTTLAKAVFNHMSTDYDASCFIENFDEAFHKEGLHRLLKERIGKILKDEFDIESSYIMRPTLHRDKLYDKRILVVLDDVRDSLAAESFLKRLDWFGSGSLIIITSVDKQVFAFCQINQIYTVQGLNVHEALQLFSQSVFGINEPEQNDRKLSMKVIDYVNGNPLALSIYGRELMGKKSEMETAFFELKHCPPLKIQDVLKNAYSALSDNEKNIVLDIAFFFKGETVNYVMQLLEESHYFPRLAIDVLVDKCVLTISENTVQMNNLIQDTCQEIFNGEIETCTRMWEPSRIRYLLEYDELEGSGETKAMPKSGLVAEHIESIFLDTSNVKFDVKHDAFKNMFNLKFLKIYNSCSKYISGLNFPKGLDSLPYELRLLHWENYPLQSLPQDFDFGHLVKLSMPYSQLHKLGTRVKDLVMLKRLILSHSLQLVECDILIYAQNIELIDLQGCTGLQRFPDTSQLQNLRVVNLSGCTEIKCFSGVPPNIEELHLQGTRIREIPIFNATHPPKVKLDRKKLWNLLENFSDVEHIDLECVTNLATVTSNNHVMGKLVCLNMKYCSNLRGLPDMVSLESLKVLYLSGCSELEKIMGFPRNLKKLYVGGTAIRELPQLPNSLEFLNAHGCKHLKSINLDFEQLPRHFIFSNCYRFSSQVIAEFVEKGLVASLARAKQEELIKAPEVIICIPMDTRQRSSFRLQAGRNAMTDLVPWMQKPISGFSMSVVVSFQDDYHNDVGLRIRCVGTWKTWNNQPDRIVERFFQCWAPTEAPKVVADHIFVLYDTKMHPSDSEENHISMWAHEVKFEFHTVSGENNPLGASCKVTECGVEVITAATGDTSVSGIIRESETITIIEKEDTIIDEEDTPLLSRKPEETNRSRSSSELQKLSSTSSKVRSKGNVFWKWLGCFPLQPKNLRSRSRRTTALEEALEEALKEREKLEDTRELQIALIESKKIKKIKQADERDQIKHADEREQRKHSKDHEEEEIESNEKEERRHSKDYVIEELVLKGKGKRKQLDDDKADEKEQIKHSKDHVEEEVNPPLSKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPCYKELRHPNCYVCEKKIPRTAEGLKYHEHPFWMETYCPSHDGDGTPKCCSCERLEHCGTQYVMLADFRWLCRECMDSAIMDSDECQPLHFEIREFFEGLHMKIEEEFPVYLVEKNALNKAEKEEKIDKQGDQCLMVVRGICLSEEQIVTSVSQGVRRMLNKQILDTVTESQRVVRKCEVTAILILYGLPRLLTGYILAHEMMHAYLRLNGYRNLNMVLEEGLCQVLGYMWLECQTYVFDTATIASSSSSSRTPLSTTTSKKVDPSDFEKRLVNFCKHQIETDESPFFGDGFRKVNKMMASNNHSLKDTLKEIISISKTPQYS

HMMPanther: PTHR24209
2-1611 PTHR24209,FAMILY NOT NAMED

EPPAARVTPSIKADCSHSVNIICEETVLHSLVSHLSAALRREGISVFVDACGLQETKFFSIKQNQPLTDGARVLVVVISDEVEFYDPWFPKFLKVIQGWQNNGHVVVPVFYGVDSLTRVYGWANSWLEAEKLTSHQSKILSNNVLTDSELVEEIVRDVYGKLYPAERVGIYARLLEIEKLLYKQHRDIRSIGIWGMPGIGKTTLAKAVFNHMSTDYDASCFIENFDEAFHKEGLHRLLKERIGKILKDEFDIESSYIMRPTLHRDKLYDKRILVVLDDVRDSLAAESFLKRLDWFGSGSLIIITSVDKQVFAFCQINQIYTVQGLNVHEALQLFSQSVFGINEPEQNDRKLSMKVIDYVNGNPLALSIYGRELMGKKSEMETAFFELKHCPPLKIQDVLKNAYSALSDNEKNIVLDIAFFFKGETVNYVMQLLEESHYFPRLAIDVLVDKCVLTISENTVQMNNLIQDTCQEIFNGEIETCTRMWEPSRIRYLLEYDELEGSGETKAMPKSGLVAEHIESIFLDTSNVKFDVKHDAFKNMFNLKFLKIYNSCSKYISGLNFPKGLDSLPYELRLLHWENYPLQSLPQDFDFGHLVKLSMPYSQLHKLGTRVKDLVMLKRLILSHSLQLVECDILIYAQNIELIDLQGCTGLQRFPDTSQLQNLRVVNLSGCTEIKCFSGVPPNIEELHLQGTRIREIPIFNATHPPKVKLDRKKLWNLLENFSDVEHIDLECVTNLATVTSNNHVMGKLVCLNMKYCSNLRGLPDMVSLESLKVLYLSGCSELEKIMGFPRNLKKLYVGGTAIRELPQLPNSLEFLNAHGCKHLKSINLDFEQLPRHFIFSNCYRFSSQVIAEFVEKGLVASLARAKQEELIKAPEVIICIPMDTRQRSSFRLQAGRNAMTDLVPWMQKPISGFSMSVVVSFQDDYHNDVGLRIRCVGTWKTWNNQPDRIVERFFQCWAPTEAPKVVADHIFVLYDTKMHPSDSEENHISMWAHEVKFEFHTVSGENNPLGASCKVTECGVEVITAATGDTSVSGIIRESETITIIEKEDTIIDEEDTPLLSRKPEETNRSRSSSELQKLSSTSSKVRSKGNVFWKWLGCFPLQPKNLRSRSRRTTALEEALEEALKEREKLEDTRELQIALIESKKIKKIKQADERDQIKHADEREQRKHSKDHEEEEIESNEKEERRHSKDYVIEELVLKGKGKRKQLDDDKADEKEQIKHSKDHVEEEVNPPLSKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPCYKELRHPNCYVCEKKIPRTAEGLKYHEHPFWMETYCPSHDGDGTPKCCSCERLEHCGTQYVMLADFRWLCRECMDSAIMDSDECQPLHFEIREFFEGLHMKIEEEFPVYLVEKNALNKAEKEEKIDKQGDQCLMVVRGICLSEEQIVTSVSQGVRRMLNKQILDTVTESQRVVRKCEVTAILILYGLPRLLTGYILAHEMMHAYLRLNGYRNLNMVLEEGLCQVLGYMWLECQTYVFDTATIASSSSSSRTPLSTTTSKKVDPSDFEKRLVNFCKHQIETDESPFFGDGFRKVNKMMASNNHSLKDTLKEIISISKTPQYS

superfamily: SSF52540
149-376 SSF52540

SELVEEIVRDVYGKLYPAERVGIYARLLEIEKLLYKQHRDIRSIGIWGMPGIGKTTLAKAVFNHMSTDYDASCFIENFDEAFHKEGLHRLLKERIGKILKDEFDIESSYIMRPTLHRDKLYDKRILVVLDDVRDSLAAESFLKRLDWFGSGSLIIITSVDKQVFAFCQINQIYTVQGLNVHEALQLFSQSVFGINEPEQNDRKLSMKVIDYVNGNPLALSIYGRELMG

Gene3D: G3DSA:3.40.50.300
156-206 G3DSA:3.40.50.300

VRDVYGKLYPAERVGIYARLLEIEKLLYKQHRDIRSIGIWGMPGIGKTTLA

HMMPfam: PF00931
IPR002182
178-427 NB-ARC,NBS
NB-ARC

IEKLLYKQHRDIRSIGIWGMPGIGKTTLAKAVFNHMSTDYDASCFIENFDEAFHKEGLHRLLKERIGKILKDEFDIESSYIMRPTLHRDKLYDKRILVVLDDVRDSLAAESFLKRLDWFGSGSLIIITSVDKQVFAFCQINQIYTVQGLNVHEALQLFSQSVFGINEPEQNDRKLSMKVIDYVNGNPLALSIYGRELMGKKSEMETAFFELKHCPPLKIQDVLKNAYSALSDNEKNIVLDIAFFFKGETV

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

SIGIWGMPGIGKTTLA

Gene3D: G3DSA:3.40.50.300
207-252 G3DSA:3.40.50.300

KAVFNHMSTDYDASCFIENFDEAFHKEGLHRLLKERIGKILKDEFD

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

KLYDKRILVVLDDVR

Gene3D: G3DSA:3.40.50.300
305-306 G3DSA:3.40.50.300

TS

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

VNGNPLALSIYGREL

superfamily: SSF46785
394-496 SSF46785

LKIQDVLKNAYSALSDNEKNIVLDIAFFFKGETVNYVMQLLEESHYFPRLAIDVLVDKCVLTISENTVQMNNLIQDTCQEIFNGEIETCTRMWEPSRIRYLLE

superfamily: SSF52058
513-849 SSF52058,LRR

GLVAEHIESIFLDTSNVKFDVKHDAFKNMFNLKFLKIYNSCSKYISGLNFPKGLDSLPYELRLLHWENYPLQSLPQDFDFGHLVKLSMPYSQLHKLGTRVKDLVMLKRLILSHSLQLVECDILIYAQNIELIDLQGCTGLQRFPDTSQLQNLRVVNLSGCTEIKCFSGVPPNIEELHLQGTRIREIPIFNATHPPKVKLDRKKLWNLLENFSDVEHIDLECVTNLATVTSNNHVMGKLVCLNMKYCSNLRGLPDMVSLESLKVLYLSGCSELEKIMGFPRNLKKLYVGGTAIRELPQLPNSLEFLNAHGCKHLKSINLDFEQLPRHFIFSNCYRFSS

Gene3D: G3DSA:3.80.10.10
517-834 G3DSA:3.80.10.10

EHIESIFLDTSNVKFDVKHDAFKNMFNLKFLKIYNSCSKYISGLNFPKGLDSLPYELRLLHWENYPLQSLPQDFDFGHLVKLSMPYSQLHKLGTRVKDLVMLKRLILSHSLQLVECDILIYAQNIELIDLQGCTGLQRFPDTSQLQNLRVVNLSGCTEIKCFSGVPPNIEELHLQGTRIREIPIFNATHPPKVKLDRKKLWNLLENFSDVEHIDLECVTNLATVTSNNHVMGKLVCLNMKYCSNLRGLPDMVSLESLKVLYLSGCSELEKIMGFPRNLKKLYVGGTAIRELPQLPNSLEFLNAHGCKHLKSINLDFEQ

HMMPfam: PF07725
IPR011713
594-613 LRR_3
Leucine-rich repeat 3

HLVKLSMPYSQLHKLGTRVK

FPrintScan: PR00364
IPR000767
768-784 DISEASERSIST
Disease resistance protein

VSLESLKVLYLSGCSEL

Gene3D: G3DSA:3.40.50.300
1115-1152 G3DSA:3.40.50.300

RTTALEEALEEALKEREKLEDTRELQIALIESKKIKKI

superfamily: SSF57716
1230-1265 SSF57716

EEEVNPPLSKCKDCKSAIEDGISINAYGSVWHPQCF

ProfileScan: PS50023
IPR001781
1238-1297 LIM_DOMAIN_2
Zinc finger, LIM-type

SKCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPCYKELRHP

Gene3D: G3DSA:2.10.110.10
IPR001781
1239-1308 Znf_LIM
Zinc finger, LIM-type

KCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPCYKELRHPNCYVCEKKIPR

HMMSmart: SM00132
IPR001781
1239-1290 LIM
Zinc finger, LIM-type

KCKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPC

PatternScan: PS00478
IPR001781
1240-1274 LIM_DOMAIN_1
Zinc finger, LIM-type

CKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPI

HMMPfam: PF00412
IPR001781
1240-1291 LIM
Zinc finger, LIM-type

CKDCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLRGMYHKPCY

HMMPfam: PF12315
IPR022087
1387-1603 DUF3633
Protein of unknown function DUF3633

GLHMKIEEEFPVYLVEKNALNKAEKEEKIDKQGDQCLMVVRGICLSEEQIVTSVSQGVRRMLNKQILDTVTESQRVVRKCEVTAILILYGLPRLLTGYILAHEMMHAYLRLNGYRNLNMVLEEGLCQVLGYMWLECQTYVFDTATIASSSSSSRTPLSTTTSKKVDPSDFEKRLVNFCKHQIETDESPFFGDGFRKVNKMMASNNHSLKDTLKEIIS

PatternScan: PS00142
1485-1494 ZINC_PROTEASE,Neutral zinc metallopeptidases

ILAHEMMHAY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox