PRGDB00049560 (ADR1-L2)

From PRG Wiki
Jump to: navigation, search
ADR1-L2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18414666 (NM_120554)
Gene Class RPW8-NL
Domain Type LRR, NBS, LRR, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ADR1-L2 (ADR1-LIKE 2); ATP binding / nucleoside-triphosphatase/ nucleotide binding / protein binding (ADR1-L2) mRNA, complete cds.

DNA Sequence

ATGGCAGATATAATCGGCGGCGAAGTTGTGACGGAGCTCGTGAGGCAGCTCTATGCGGTTTCTCAAAAAACCCTCAGATGCAGAGGCATCGCCAAAAATCTCGCCACCATGATCGATGGTCTTCAACCAACGATCAAGGAGATCCAATACAGCGGCGTCGAGCTCACACCTCATCGCCAGGCTCAGTTGCGTATGTTCTCGGAAACCTTAGACAAGTGTAGGAAGCTCACCGAGAAAGTTCTTAAATCCAGCCGTTGGAACATGGTTAGACAGCTACTCCATGTTAGGAAAATGGAGAATCTTCAGAGTAAAGTGTCTAGCTTTCTCAACGGTCAATTGTTAGTCCATGTTCTCGCTGATGTTCATCATGTTCGAGCCGATTCTGAATTCCGGTTCGATCGGATTGATAGGAAGGTTGATAGTTTGAATGAGAAGCTTGGTTCTATGAAACTCAGGGGAAGTGAATCGTTGCGTGAGGCGTTGAAGACGGCCGAGGCTACCGTTGAGATGGTGACAACCGATGGTGCTGATTTGGGGGTGGGATTGGATTTGGGAAAGAGGAAGGTGAAGGAGATGTTGTTTAAATCCATTGATGGGGAAAGACTTATTGGTATCTCTGGGATGAGTGGTTCAGGGAAAACCACTCTTGCCAAAGAGCTTGCCCGGGACGAGGAGGTTCGAGGCCACTTTGGGAACAAGGTTTTGTTTCTGACTGTGTCACAATCTCCCAATCTTGAGGAGCTTAGAGCCCATATATGGGGATTTCTTACTAGTTATGAGGCTGGGGTTGGTGCTACTCTTCCAGAATCGAGGAAGCTAGTGATCCTTGATGATGTTTGGACAAGGGAATCTCTGGACCAGCTGATGTTCGAAAATATTCCTGGAACCACAACTCTTGTGGTCTCACGGTCTAAACTCGCAGATTCTAGAGTCACTTATGATGTAGAGTTACTCAATGAACATGAAGCAACGGCCCTGTTCTGTCTCTCTGTTTTCAATCAGAAATTAGTGCCTTCAGGGTTCAGCCAAAGTTTGGTCAAGCAGGTTGTTGGGGAGTGTAAAGGTCTACCTTTGTCTCTGAAAGTCATTGGTGCTTCATTGAAAGAACGACCTGAAAAATATTGGGAAGGTGCAGTGGAGAGGCTATCAAGAGGTGAACCTGCTGATGAAACTCATGAGAGTAGAGTGTTTGCTCAAATCGAAGCAACTCTAGAAAATCTTGACCCTAAAACCAGAGATTGTTTCTTGGTTCTCGGTGCTTTCCCTGAAGATAAGAAGATCCCTCTTGATGTTCTCATCAACGTGTTGGTTGAGTTGCATGATCTCGAGGATGCAACTGCTTTTGCTGTTATTGTTGATTTAGCAAACAGGAATCTCCTTACTCTTGTGAAAGATCCAAGGTTTGGACATATGTACACTAGCTACTATGATATATTTGTCACGCAGCATGATGTTCTAAGAGATGTAGCACTTCGTCTTAGCAATCATGGGAAAGTAAATAACAGAGAGCGGTTATTGATGCCAAAAAGAGAGTCAATGCTTCCGAGAGAATGGGAGAGGAACAATGATGAGCCATACAAAGCCAGAGTAGTTTCCATTCACACAGGAGAAATGACTCAGATGGATTGGTTTGACATGGAACTCCCTAAGGCTGAAGTTTTGATACTACACTTCTCTTCTGACAAGTATGTATTGCCTCCTTTCATTGCTAAGATGGGCAAGCTTACAGCGCTCGTGATCATCAACAATGGTATGTCTCCTGCGCGTCTACATGACTTCTCCATCTTTACCAATTTGGCCAAACTCAAGAGTCTCTGGCTTCAGAGGGTTCATGTCCCTGAACTCTCTAGCAGTACAGTGCCCTTGCAAAACCTCCACAAGCTGTCTCTCATATTCTGCAAGATCAACACTAGTCTTGATCAGACAGAGCTAGACATTGCCCAAATCTTCCCAAAATTGTCTGATCTTACAATAGATCATTGTGATGATCTTCTGGAACTACCTTCGACCATCTGTGGAATCACCTCTCTCAATTCCATCAGCATAACAAATTGTCCCCGCATCAAGGAATTGCCTAAGAATCTGAGTAAGCTAAAAGCCCTTCAGCTTCTGAGGCTATACGCTTGCCATGAGCTGAATTCTCTGCCTGTGGAAATCTGTGAACTGCCAAGACTAAAGTATGTTGACATTTCTCAATGTGTCAGCCTGAGTTCTCTTCCGGAAAAGATAGGAAAGGTAAAGACACTTGAGAAAATCGACACGAGGGAATGCAGCTTATCGAGCATACCAAACTCTGTGGTTTTATTGACTTCTCTACGCCATGTAATATGCGATAGAGAGGCTTTATGGATGTGGGAAAAGGTCCAGAAGGCGGTTGCAGGACTTCGTGTTGAAGCTGCGGAAAAATCTTTCAGCAGGGATTGGCTCGACGATTAG


Protein sequences

Name Description Sequence
ADR1-L2 (ADR1-LIKE 2); ATP binding / nucleoside-triphosphatase/ nucleotide binding / protein binding ADR1-L2 (ADR1-LIKE 2); ATP binding / nucleoside-triphosphatase/ nucleotide binding / protein binding [Arabidopsis thaliana].

MADIIGGEVVTELVRQLYAVSQKTLRCRGIAKNLATMIDGLQPTIKEIQYSGVELTPHRQAQLRMFSETLDKCRKLTEKVLKSSRWNMVRQLLHVRKMENLQSKVSSFLNGQLLVHVLADVHHVRADSEFRFDRIDRKVDSLNEKLGSMKLRGSESLREALKTAEATVEMVTTDGADLGVGLDLGKRKVKEMLFKSIDGERLIGISGMSGSGKTTLAKELARDEEVRGHFGNKVLFLTVSQSPNLEELRAHIWGFLTSYEAGVGATLPESRKLVILDDVWTRESLDQLMFENIPGTTTLVVSRSKLADSRVTYDVELLNEHEATALFCLSVFNQKLVPSGFSQSLVKQVVGECKGLPLSLKVIGASLKERPEKYWEGAVERLSRGEPADETHESRVFAQIEATLENLDPKTRDCFLVLGAFPEDKKIPLDVLINVLVELHDLEDATAFAVIVDLANRNLLTLVKDPRFGHMYTSYYDIFVTQHDVLRDVALRLSNHGKVNNRERLLMPKRESMLPREWERNNDEPYKARVVSIHTGEMTQMDWFDMELPKAEVLILHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDREALWMWEKVQKAVAGLRVEAAEKSFSRDWLDD

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-147 RPW8
Powdery mildew resistance protein, RPW8 domain

MADIIGGEVVTELVRQLYAVSQKTLRCRGIAKNLATMIDGLQPTIKEIQYSGVELTPHRQAQLRMFSETLDKCRKLTEKVLKSSRWNMVRQLLHVRKMENLQSKVSSFLNGQLLVHVLADVHHVRADSEFRFDRIDRKVDSLNEKLG

HMMPfam: PF05659
IPR008808
11-126 RPW8
Powdery mildew resistance protein, RPW8 domain

TELVRQLYAVSQKTLRCRGIAKNLATMIDGLQPTIKEIQYSGVELTPHRQAQLRMFSETLDKCRKLTEKVLKSSRWNMVRQLLHVRKMENLQSKVSSFLNGQLLVHVLADVHHVRA

HMMPanther: PTHR23155:SF282
23-784 PTHR23155:SF282,SUBFAMILY NOT NAMED

KTLRCRGIAKNLATMIDGLQPTIKEIQYSGVELTPHRQAQLRMFSETLDKCRKLTEKVLKSSRWNMVRQLLHVRKMENLQSKVSSFLNGQLLVHVLADVHHVRADSEFRFDRIDRKVDSLNEKLGSMKLRGSESLREALKTAEATVEMVTTDGADLGVGLDLGKRKVKEMLFKSIDGERLIGISGMSGSGKTTLAKELARDEEVRGHFGNKVLFLTVSQSPNLEELRAHIWGFLTSYEAGVGATLPESRKLVILDDVWTRESLDQLMFENIPGTTTLVVSRSKLADSRVTYDVELLNEHEATALFCLSVFNQKLVPSGFSQSLVKQVVGECKGLPLSLKVIGASLKERPEKYWEGAVERLSRGEPADETHESRVFAQIEATLENLDPKTRDCFLVLGAFPEDKKIPLDVLINVLVELHDLEDATAFAVIVDLANRNLLTLVKDPRFGHMYTSYYDIFVTQHDVLRDVALRLSNHGKVNNRERLLMPKRESMLPREWERNNDEPYKARVVSIHTGEMTQMDWFDMELPKAEVLILHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDREALWM

HMMPanther: PTHR23155
23-784 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KTLRCRGIAKNLATMIDGLQPTIKEIQYSGVELTPHRQAQLRMFSETLDKCRKLTEKVLKSSRWNMVRQLLHVRKMENLQSKVSSFLNGQLLVHVLADVHHVRADSEFRFDRIDRKVDSLNEKLGSMKLRGSESLREALKTAEATVEMVTTDGADLGVGLDLGKRKVKEMLFKSIDGERLIGISGMSGSGKTTLAKELARDEEVRGHFGNKVLFLTVSQSPNLEELRAHIWGFLTSYEAGVGATLPESRKLVILDDVWTRESLDQLMFENIPGTTTLVVSRSKLADSRVTYDVELLNEHEATALFCLSVFNQKLVPSGFSQSLVKQVVGECKGLPLSLKVIGASLKERPEKYWEGAVERLSRGEPADETHESRVFAQIEATLENLDPKTRDCFLVLGAFPEDKKIPLDVLINVLVELHDLEDATAFAVIVDLANRNLLTLVKDPRFGHMYTSYYDIFVTQHDVLRDVALRLSNHGKVNNRERLLMPKRESMLPREWERNNDEPYKARVVSIHTGEMTQMDWFDMELPKAEVLILHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDREALWM

superfamily: SSF52540
186-384 SSF52540

KRKVKEMLFKSIDGERLIGISGMSGSGKTTLAKELARDEEVRGHFGNKVLFLTVSQSPNLEELRAHIWGFLTSYEAGVGATLPESRKLVILDDVWTRESLDQLMFENIPGTTTLVVSRSKLADSRVTYDVELLNEHEATALFCLSVFNQKLVPSGFSQSLVKQVVGECKGLPLSLKVIGASLKERPEKYWEGAVERLSR

HMMPfam: PF00931
IPR002182
187-437 NB-ARC,NBS
NB-ARC

RKVKEMLFKSIDGERLIGISGMSGSGKTTLAKELARDEEVRGHFGNKVLFLTVSQSPNLEELRAHIWGFLTSYEAGVGATLPESRKLVILDDVWTRESLDQLMFENIPGTTTLVVSRSKLADSRVTYDVELLNEHEATALFCLSVFNQKLVPSGFSQSLVKQVVGECKGLPLSLKVIGASLKERPEKYWEGAVERLSRGEPADETHESRVFAQIEATLENLDPKTRDCFLVLGAFPEDKKIPLDVLINVLV

HMMSmart: SM00382
IPR003593
199-321 AAA,NBS
AAA+ ATPase domain

GERLIGISGMSGSGKTTLAKELARDEEVRGHFGNKVLFLTVSQSPNLEELRAHIWGFLTSYEAGVGATLPESRKLVILDDVWTRESLDQLMFENIPGTTTLVVSRSKLADSRVTYDVELLNEH

Gene3D: G3DSA:3.40.50.300
201-222 G3DSA:3.40.50.300

RLIGISGMSGSGKTTLAKELAR

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

LIGISGMSGSGKTTLA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

TLPESRKLVILDDVW

FPrintScan: PR00364
IPR000767
353-367 DISEASERSIST
Disease resistance protein

CKGLPLSLKVIGASL

superfamily: SSF52058
481-779 SSF52058,LRR

TQHDVLRDVALRLSNHGKVNNRERLLMPKRESMLPREWERNNDEPYKARVVSIHTGEMTQMDWFDMELPKAEVLILHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHVICDR

Gene3D: G3DSA:3.80.10.10
555-775 G3DSA:3.80.10.10

ILHFSSDKYVLPPFIAKMGKLTALVIINNGMSPARLHDFSIFTNLAKLKSLWLQRVHVPELSSSTVPLQNLHKLSLIFCKINTSLDQTELDIAQIFPKLSDLTIDHCDDLLELPSTICGITSLNSISITNCPRIKELPKNLSKLKALQLLRLYACHELNSLPVEICELPRLKYVDISQCVSLSSLPEKIGKVKTLEKIDTRECSLSSIPNSVVLLTSLRHV

FPrintScan: PR00364
IPR000767
720-736 DISEASERSIST
Disease resistance protein

CELPRLKYVDISQCVSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox