PRGDB00049561 (ADR1-L3)

From PRG Wiki
Jump to: navigation, search
ADR1-L3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422776 (NM_124099)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ADR1-L3 (ADR1-LIKE 3); ATP binding / nucleoside-triphosphatase/ nucleotide binding / protein binding (ADR1-L3) mRNA, complete cds.

DNA Sequence

ATGCTTTTTAATTTGAACGATGAGGCAAGAATTATTGGGATCTCAGGGATGATCGGTTCAGGGAAAACCATTCTTGCCAAGGAGCTTGCGCGGGACGAGGAGGTCCGAGGCCATTTTGCGAACCGAGTTTTGTTTCTGACTGTGTCACAATCTCCCAATCTTGAGGAGCTGAGATCCCTTATACGGGATTTTCTTACTGGTCATGAGGCTGGCTTTGGTACCGCTCTTCCGGAATCCGTTGGTCATACACGGAAGCTAGTGATCCTTGATGATGTTAGGACAAGGGAATCTCTAGACCAGCTGATGTTCAATATTCCTGGAACCACAACGCTTGTGGTCTCACAGTCTAAACTCGTAGATCCTAGAACCACCTATGATGTAGAGTTATTAAATGAACATGACGCAACATCTCTGTTCTGTCTCTCTGCTTTCAACCAGAAATCAGTTCCTTCAGGGTTCAGCAAAAGTTTGGTCAAGCAGGTTGTTGGGGAGTCTAAAGGTCTACCTTTGTCTCTGAAAGTCCTTGGCGCTTCATTAAACGATCGACCTGAAACATATTGGGCAATTGCAGTGGAGAGGTTATCAAGAGGTGAACCTGTTGATGAAACTCATGAGAGTAAAGTGTTTGCTCAAATCGAAGCAACTCTAGAAAATCTCGATCCAAAAACCAAAGAGTGTTTCTTGGATATGGGTGCTTTCCCTGAAGGCAAGAAAATCCCTGTTGATGTTCTCATCAACATGTTGGTCAAGATACATGATCTTGAGGACGCAGCCGCCTTTGATGTTCTTGTTGATCTAGCAAATAGGAATCTTCTTACTCTCGTGAAAGATCCAACGTTTGTCGCTATGGGCACTAGCTACTATGATATATTCGTGACGCAGCACGATGTTTTAAGAGATGTAGCACTTCATCTTACCAATCGTGGAAAAGTAAGTAGAAGAGACCGCTTATTGATGCCAAAAAGAGAGACCATGCTTCCCAGCGAATGGGAGAGGAGCAATGATGAGCCATACAATGCACGAGTGGTTTCCATTCACACAGGAGAAATGACTGAGATGGACTGGTTTGACATGGATTTCCCCAAGGCAGAAGTTCTGATAGTAAACTTCTCTTCAGACAACTATGTATTGCCTCCTTTCATTGCTAAGATGGGAATGCTTAGGGTGTTCGTGATTATAAACAACGGTACCTCTCCAGCGCATCTACATGACTTCCCCATCCCTACCAGTTTGACCAATCTAAGGAGTCTCTGGCTTGAGAGGGTTCATGTCCCTGAACTCTCTAGCAGTATGATACCCTTGAAAAACCTCCACAAGCTATATCTGATTATTTGCAAGATCAATAACAGTTTTGATCAGACAGCCATAGACATTGCCCAAATCTTCCCAAAATTGACTGATATCACAATAGATTATTGCGATGATCTTGCGGAACTACCTTCGACCATCTGTGGAATAACCTCTCTCAACTCCATCAGCATAACAAATTGTCCCAACATCAAGGAGTTACCGAAGAATATAAGTAAGCTACAAGCCCTTCAACTTTTGAGGCTATACGCTTGCCCAGAGCTAAAATCTCTGCCTGTGGAAATCTGTGAATTGCCAAGACTAGTGTATGTCGACATCTCTCACTGTCTCAGCCTAAGTTCTCTTCCGGAAAAGATAGGAAATGTAAGGACACTTGAGAAAATCGACATGAGAGAATGTAGCTTATCGAGCATACCAAGTTCCGCAGTTTCATTGACTTCCCTATGCTATGTAACATGCTATAGAGAGGCTTTGTGGATGTGGAAAGAGGTTGAGAAGGCAGTTCCCGGACTTCGTATTGAAGCTACTGAAAAATGGTTCAACATGACTTGGCCCGACGAGTAG


Protein sequences

Name Description Sequence
ADR1-L3 (ADR1-LIKE 3); ATP binding / nucleoside-triphosphatase/ nucleotide binding / protein binding ADR1-L3 (ADR1-LIKE 3); ATP binding / nucleoside-triphosphatase/ nucleotide binding / protein binding [Arabidopsis thaliana].

MLFNLNDEARIIGISGMIGSGKTILAKELARDEEVRGHFANRVLFLTVSQSPNLEELRSLIRDFLTGHEAGFGTALPESVGHTRKLVILDDVRTRESLDQLMFNIPGTTTLVVSQSKLVDPRTTYDVELLNEHDATSLFCLSAFNQKSVPSGFSKSLVKQVVGESKGLPLSLKVLGASLNDRPETYWAIAVERLSRGEPVDETHESKVFAQIEATLENLDPKTKECFLDMGAFPEGKKIPVDVLINMLVKIHDLEDAAAFDVLVDLANRNLLTLVKDPTFVAMGTSYYDIFVTQHDVLRDVALHLTNRGKVSRRDRLLMPKRETMLPSEWERSNDEPYNARVVSIHTGEMTEMDWFDMDFPKAEVLIVNFSSDNYVLPPFIAKMGMLRVFVIINNGTSPAHLHDFPIPTSLTNLRSLWLERVHVPELSSSMIPLKNLHKLYLIICKINNSFDQTAIDIAQIFPKLTDITIDYCDDLAELPSTICGITSLNSISITNCPNIKELPKNISKLQALQLLRLYACPELKSLPVEICELPRLVYVDISHCLSLSSLPEKIGNVRTLEKIDMRECSLSSIPSSAVSLTSLCYVTCYREALWMWKEVEKAVPGLRIEATEKWFNMTWPDE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-596 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MLFNLNDEARIIGISGMIGSGKTILAKELARDEEVRGHFANRVLFLTVSQSPNLEELRSLIRDFLTGHEAGFGTALPESVGHTRKLVILDDVRTRESLDQLMFNIPGTTTLVVSQSKLVDPRTTYDVELLNEHDATSLFCLSAFNQKSVPSGFSKSLVKQVVGESKGLPLSLKVLGASLNDRPETYWAIAVERLSRGEPVDETHESKVFAQIEATLENLDPKTKECFLDMGAFPEGKKIPVDVLINMLVKIHDLEDAAAFDVLVDLANRNLLTLVKDPTFVAMGTSYYDIFVTQHDVLRDVALHLTNRGKVSRRDRLLMPKRETMLPSEWERSNDEPYNARVVSIHTGEMTEMDWFDMDFPKAEVLIVNFSSDNYVLPPFIAKMGMLRVFVIINNGTSPAHLHDFPIPTSLTNLRSLWLERVHVPELSSSMIPLKNLHKLYLIICKINNSFDQTAIDIAQIFPKLTDITIDYCDDLAELPSTICGITSLNSISITNCPNIKELPKNISKLQALQLLRLYACPELKSLPVEICELPRLVYVDISHCLSLSSLPEKIGNVRTLEKIDMRECSLSSIPSSAVSLTSLCYVTCYREALWM

HMMPanther: PTHR23155:SF283
1-596 PTHR23155:SF283,ADR1-L3 (ADR1-LIKE 3)

MLFNLNDEARIIGISGMIGSGKTILAKELARDEEVRGHFANRVLFLTVSQSPNLEELRSLIRDFLTGHEAGFGTALPESVGHTRKLVILDDVRTRESLDQLMFNIPGTTTLVVSQSKLVDPRTTYDVELLNEHDATSLFCLSAFNQKSVPSGFSKSLVKQVVGESKGLPLSLKVLGASLNDRPETYWAIAVERLSRGEPVDETHESKVFAQIEATLENLDPKTKECFLDMGAFPEGKKIPVDVLINMLVKIHDLEDAAAFDVLVDLANRNLLTLVKDPTFVAMGTSYYDIFVTQHDVLRDVALHLTNRGKVSRRDRLLMPKRETMLPSEWERSNDEPYNARVVSIHTGEMTEMDWFDMDFPKAEVLIVNFSSDNYVLPPFIAKMGMLRVFVIINNGTSPAHLHDFPIPTSLTNLRSLWLERVHVPELSSSMIPLKNLHKLYLIICKINNSFDQTAIDIAQIFPKLTDITIDYCDDLAELPSTICGITSLNSISITNCPNIKELPKNISKLQALQLLRLYACPELKSLPVEICELPRLVYVDISHCLSLSSLPEKIGNVRTLEKIDMRECSLSSIPSSAVSLTSLCYVTCYREALWM

HMMPfam: PF00931
IPR002182
2-250 NB-ARC,NBS
NB-ARC

LFNLNDEARIIGISGMIGSGKTILAKELARDEEVRGHFANRVLFLTVSQSPNLEELRSLIRDFLTGHEAGFGTALPESVGHTRKLVILDDVRTRESLDQLMFNIPGTTTLVVSQSKLVDPRTTYDVELLNEHDATSLFCLSAFNQKSVPSGFSKSLVKQVVGESKGLPLSLKVLGASLNDRPETYWAIAVERLSRGEPVDETHESKVFAQIEATLENLDPKTKECFLDMGAFPEGKKIPVDVLINMLVK

Gene3D: G3DSA:3.40.50.300
6-31 G3DSA:3.40.50.300

NDEARIIGISGMIGSGKTILAKELAR

superfamily: SSF52540
7-212 SSF52540

DEARIIGISGMIGSGKTILAKELARDEEVRGHFANRVLFLTVSQSPNLEELRSLIRDFLTGHEAGFGTALPESVGHTRKLVILDDVRTRESLDQLMFNIPGTTTLVVSQSKLVDPRTTYDVELLNEHDATSLFCLSAFNQKSVPSGFSKSLVKQVVGESKGLPLSLKVLGASLNDRPETYWAIAVERLSRGEPVDETHESKVFAQI

HMMSmart: SM00382
IPR003593
8-133 AAA,NBS
AAA+ ATPase domain

EARIIGISGMIGSGKTILAKELARDEEVRGHFANRVLFLTVSQSPNLEELRSLIRDFLTGHEAGFGTALPESVGHTRKLVILDDVRTRESLDQLMFNIPGTTTLVVSQSKLVDPRTTYDVELLNEH

FPrintScan: PR00364
IPR000767
11-26 DISEASERSIST
Disease resistance protein

IIGISGMIGSGKTILA

FPrintScan: PR00364
IPR000767
79-93 DISEASERSIST
Disease resistance protein

SVGHTRKLVILDDVR

FPrintScan: PR00364
IPR000767
165-179 DISEASERSIST
Disease resistance protein

SKGLPLSLKVLGASL

superfamily: SSF52047
360-587 SSF52047,LRR

FPKAEVLIVNFSSDNYVLPPFIAKMGMLRVFVIINNGTSPAHLHDFPIPTSLTNLRSLWLERVHVPELSSSMIPLKNLHKLYLIICKINNSFDQTAIDIAQIFPKLTDITIDYCDDLAELPSTICGITSLNSISITNCPNIKELPKNISKLQALQLLRLYACPELKSLPVEICELPRLVYVDISHCLSLSSLPEKIGNVRTLEKIDMRECSLSSIPSSAVSLTSLCYV

Gene3D: G3DSA:3.80.10.10
376-585 G3DSA:3.80.10.10

VLPPFIAKMGMLRVFVIINNGTSPAHLHDFPIPTSLTNLRSLWLERVHVPELSSSMIPLKNLHKLYLIICKINNSFDQTAIDIAQIFPKLTDITIDYCDDLAELPSTICGITSLNSISITNCPNIKELPKNISKLQALQLLRLYACPELKSLPVEICELPRLVYVDISHCLSLSSLPEKIGNVRTLEKIDMRECSLSSIPSSAVSLTSLC

FPrintScan: PR00364
IPR000767
532-548 DISEASERSIST
Disease resistance protein

CELPRLVYVDISHCLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox