PRGDB00049562 (mob1/phocein family protein)

From PRG Wiki
Jump to: navigation, search
mob1/phocein family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18415227 (NM_118023)
Gene Class NL
Domain Type LRR, NBS, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana mob1/phocein family protein (AT4G19050) mRNA, complete cds.

DNA Sequence

ATGGAGAAGCAAGATCAAACAAGCAGAGAAGAGATTCTGAAGAAGATAATGGATTCATTGGGACAAGACGGTGTACCTTCAAAAACCGTCCTCGTTGGTGAAGCTGGTATAGGGAAGACATGGCTTGCAAAAGAAGTCAGCCAACGTGTTACTCAAGAAAAGTACAATGTCCTCTGGTTACACCTGAACAAAAAGATTGAAGACGAGAAGTCGCTTTACGAGATTCTAGCTGCTCAGTTGTCGATAATTTACGAGTTTGAAGAAGGCGAAGAACCTGATGAGCTTGATTATCCATTGGAGAGCTTGAAAGAGAAGATTAAAGAAGAGATGATCAAACACAAGAAGGATAATCTTCTGTTGATTTTGGATGATGAAGGAAGTATGACAACTGAAGAAGATGTGATGCAAGAATTAAACCTCCAAGATTTTCTTAAGGAGTACTCGGCTGTGAAGATTCTAGTCACAAGAAGAGATGAAAGAGAGGAGAAAGAATCCACAACGATCAAAGTCGGTCCGCTTACAGAAAAGGAGTCATTGGACTTACTCCACGATGCCGAGGACTTACTTACATCATTTACCTCTGAAGATTGGCCTGTTCTGCTAAAGAGACTTTGCGATAACAAAGAGATCAAAGAACCTACTTTGATGTCTTGCATTTTAAGCAAGAGCAAGGGCTTACCAGCTGCGATCGTTGTCTTAATCAAGTCTTTAAACAGCATTAAGTCGATGTCTGCGAAGCAGAGGAAGATCTTTAAAGAACTGATTCTATCTTCCAAGTCATTAGATGAAGCAGCTGCTTCCAAGAACGCTATAGATCGCAGCCGCTACAATCCTGTCTTGCAATTAAGCTACGAGCTGTTAAAGCCTGACGAGACGGTCAAACGTCCGGTGATTGCTTGCTTTTGGCATATCTTGGACTTCTACAAGTACTCTGGATGCGCTTACTACCGTGACCTAATAGTGCATTGGATGCTTGAAGGGTATTTTGATCCGGTTAAGTCAGTTGACAAAGCTTACCAAGAAGGACATTCCATTTTAATGGACTTTATGAACAGAGGAATCTTGAAAATACAAGAAGACAACATGGTGGTTCCAGAGTTCTCCATGAGCAACCTATTAGATCTTCAAGATTGTGGATTCTTTGGAAGATCTTCTCTTGGATTTGACAGAGTTTACGGTGGAGACAAGAGAAAGGGGCTAGGGAAAATCATCTTGATCGATGATATGATACAGACAATTCAATCGAAGAAGAAGAATATCACGACGATTATCGCTAGCGGAAACCGTTTACGTAGAGAGGTTCATGGGAAGTTCTTTGAGAAACCAGAGATGCAAGATCTTGAAGTTGTAGTCCTCTTTGAGCCAACGTTCCATGAACTTGTTCTGTCTTTATCTAAGCTAAAGAAACTCCGAGTACTTGTTATCAGAGACTGTGATCTAATCGATAACATCGATAAGCTCAGTGGTCTTCAAGGCCTACATGTTCTTGAAGTCTCTGGTGCTAGCTCTCTAGTTAACATCCCTGATGATTTCTTCAAGAACATGACTCAGCTTCAAAGCCTTAATCTTTCGGGACTTGCAATCAAATCTTCGCCTTCCACAATCGAAAAGCTAAGCATGCTTCGTTGCTTCATCCTAAGGCACTGCTCTGAGCTACAAGATCTGCCTAACTTCATTGTGGAAACAAGAAAACTTGAAGTTATTGACATTCACGGAGCTAGGAAACTTGAGTCTTACTTTGATAGAGTTAAAGATTGGAAGGACTATAAAGGCAAGAACAAGAACTTTGCTCAGCTTCAGCTGCTTGAACACCTAGACTTCTCAGAGACTAAAATCATCCGTCTGCCGATATTTCATCTCAAAGACTCTACTAACGATTTCAGTACTATGCCAATCTTGACCCGGCTCTTGCTGAGAAACTGTACAAGGCTTAAGAGATTGCCACAGCTTAGGCCTTTGACTAATCTTCAGATTCTTGATGCATGTGGTGCTACAGACTTAGTGGAGATGCTTGAAGTGTGTTTAGAGGAGAAGAAAGAGCTTAGGATCCTCGATATGTCAAAGACAAGTCTTCCCGAGTTAGCCGACACGATTGCTGATGTTGTCAATCTCAATAAGCTTCTGTTAAGGAATTGCTCACTGATTGAAGAGCTTCCAAGCATTGAGAAACTGACACACCTTGAAGTTTTCGACGTTTCTGGTTGCATTAAGTTGAAGAATATCAATGGATCCTTTGGGGAGATGTCTTACCTCCATGAAGTGAATCTTTCAGAAACTAATCTTAGTGAGTTACCTGACAAAATCTCAGAGCTATCTAACCTTAAGGAGCTCATCATAAGAAAATGTTCCAAGCTAAAGACTCTTCCAAACCTTGAGAAGCTAACAAATCTTGAGATCTTCGATGTTTCGGGCTGCACCGAGTTGGAAACAATCGAGGGATCATTCGAGAATCTGTCTTGCCTCCACAAAGTGAATCTTTCGGAAACTAATCTTGGTGAGTTACCTAACAAAATCTCAGAGCTATCTAACCTCAAAGAGCTCATCCTAAGAAACTGTTCTAAGCTAAAGGCTCTTCCAAATCTTGAGAAGCTAACACATCTAGTGATCTTCGATGTTTCGGGATGCACCAATCTGGATAAAATCGAGGAATCATTCGAGAGTATGTCTTACCTTTGCGAGAGCATCCTCTGTTCTTCAAAACGTATTGTTCTCGCGGATTCGAGTTGTATAGAGCGAGACCAGTGGAGCCAAATAAAAGAGTGTTTAACAAGTAAGTCAGAGGGCTCTAGCTTCTCTAATGTAGGGGAAAAAACCCGCGAGAAACTTCTTTATCACGGCAATAGATACAGAGTTATTGATCCTGAAGTTCCTTTGAATATCGATATTGTTGACATCAAAAGATCCACTGATCTTAAAACAGAGTATATAGCCAAAGCAGAGTATGTCTCTATAGCAGAGAATGGATCCAAAAGCGTATCTTCTCTCTTCGACGAGTTGCAGATGGCATCGGTAAAAGGTTGTTGGGTAGAGAGGTGCAAGAACATGGATGTTCTCTTCGAATCAGATGAACAACTAGAGAAAGAGAAATCATCATCACCATCATTGCAGACTCTTTGGATCTCAAATCTTCCATTGCTAACAAGCTTATACAGTAGTAAAGGAGGATTCATTTTCAAGAACCTTAAGAAGCTAAGCGTAGATTGTTGTCCAAGCATCAAATGGCTATTCCCGGAGATTCCTGATAACCTTGAGATTCTTCGTGTGAAGTTCTGTGATAAGTTGGAGAGATTGTTTGAAGTAAAAGCAGGAGAATTATCGAAGCTTCGTAAGCTTCACCTTCTTGATTTGCCTGTTTTATCAGTACTTGGAGCTAATTTCCCGAATCTGGAGAAATGCACAATTGAGAAATGTCCGAAATTGAAAGCTAGAGAAGATGAACCGAGGATTGGAGCAAGGATTACAGATGAAATTTCAGAGGATCAACCTCACAAGAATACTATTGGGCCTGAAACCCAAACTCCTACCCAGCCCACAAAAGCTACAGACACAATCTTTCGAATAGTTATTCCTGATTGGAACTTGATGGAACCAATAAATCAAAAGACTTTCCGTCCTAAGAAGAGCGCACCATCAGGAACCAAGGGAGCAGAGCTTCGAAAGCATATAGATGCAACTTTAGGTAGTGGTAATCTTAGAGAAGCCGTCAAACTTCCTCCGGGAGAGGATTTAAACGAATGGCTTGCAGTTAACACTGTGGATTTCTTCAATCAGGTGAATCTGTTATTTGGTACACTTACCGAGTTTTGCACCCCGGAGAACTGTTCTACAATGACTGCTGGTCCCAAGTACGAATACAGATGGGCCGATGGTGTACAAATCAAGAAGCCTATTGAGGTTTCAGCTCCAAAGTATGTTGAATACTTGATGGATTGGATCGAGACACAACTCGATGATGAGACCATATTTCCTCAAAAACTTGGTGCAGCTTTTCCTCCAAACTTCAAGGAAGTGGTGAAGACAATCTTTAAACGACTATTCCGAGTTTACGCACACATATACCACTCTCATTTCCAGAAAATAGTTAGTCTCAAAGAGGAAGCTCATCTCAACACTTGCTTCAAACACTTCATCCTCTTCACTCATGAGTTTGTTCTCATTGACAAGAAAGAACTCGCTCCTCTTCAAGAACTCATAGAATCTATCATTGCACCTTACTAA


Protein sequences

Name Description Sequence
mob1/phocein family protein mob1/phocein family protein [Arabidopsis thaliana].

MEKQDQTSREEILKKIMDSLGQDGVPSKTVLVGEAGIGKTWLAKEVSQRVTQEKYNVLWLHLNKKIEDEKSLYEILAAQLSIIYEFEEGEEPDELDYPLESLKEKIKEEMIKHKKDNLLLILDDEGSMTTEEDVMQELNLQDFLKEYSAVKILVTRRDEREEKESTTIKVGPLTEKESLDLLHDAEDLLTSFTSEDWPVLLKRLCDNKEIKEPTLMSCILSKSKGLPAAIVVLIKSLNSIKSMSAKQRKIFKELILSSKSLDEAAASKNAIDRSRYNPVLQLSYELLKPDETVKRPVIACFWHILDFYKYSGCAYYRDLIVHWMLEGYFDPVKSVDKAYQEGHSILMDFMNRGILKIQEDNMVVPEFSMSNLLDLQDCGFFGRSSLGFDRVYGGDKRKGLGKIILIDDMIQTIQSKKKNITTIIASGNRLRREVHGKFFEKPEMQDLEVVVLFEPTFHELVLSLSKLKKLRVLVIRDCDLIDNIDKLSGLQGLHVLEVSGASSLVNIPDDFFKNMTQLQSLNLSGLAIKSSPSTIEKLSMLRCFILRHCSELQDLPNFIVETRKLEVIDIHGARKLESYFDRVKDWKDYKGKNKNFAQLQLLEHLDFSETKIIRLPIFHLKDSTNDFSTMPILTRLLLRNCTRLKRLPQLRPLTNLQILDACGATDLVEMLEVCLEEKKELRILDMSKTSLPELADTIADVVNLNKLLLRNCSLIEELPSIEKLTHLEVFDVSGCIKLKNINGSFGEMSYLHEVNLSETNLSELPDKISELSNLKELIIRKCSKLKTLPNLEKLTNLEIFDVSGCTELETIEGSFENLSCLHKVNLSETNLGELPNKISELSNLKELILRNCSKLKALPNLEKLTHLVIFDVSGCTNLDKIEESFESMSYLCESILCSSKRIVLADSSCIERDQWSQIKECLTSKSEGSSFSNVGEKTREKLLYHGNRYRVIDPEVPLNIDIVDIKRSTDLKTEYIAKAEYVSIAENGSKSVSSLFDELQMASVKGCWVERCKNMDVLFESDEQLEKEKSSSPSLQTLWISNLPLLTSLYSSKGGFIFKNLKKLSVDCCPSIKWLFPEIPDNLEILRVKFCDKLERLFEVKAGELSKLRKLHLLDLPVLSVLGANFPNLEKCTIEKCPKLKAREDEPRIGARITDEISEDQPHKNTIGPETQTPTQPTKATDTIFRIVIPDWNLMEPINQKTFRPKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQELIESIIAPY

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
9-261 P-loop containing nucleoside triphosphate hydrolases

REEILKKIMDSLGQDGVPSKTVLVGEAGIGKTWLAKEVSQRVTQEKYNVLWLHLNKKIEDEKSLYEILAAQLSIIYEFEEGEEPDELDYPLESLKEKIKEEMIKHKKDNLLLILDDEGSMTTEEDVMQELNLQDFLKEYSAVKILVTRRDEREEKESTTIKVGPLTEKESLDLLHDAEDLLTSFTSEDWPVLLKRLCDNKEIKEPTLMSCILSKSKGLPAAIVVLIKSLNSIKSMSAKQRKIFKELILSSKSL

HMMPfam: PF00931
IPR002182
13-300 NB-ARC,NBS
NB-ARC

LKKIMDSLGQDGVPSKTVLVGEAGIGKTWLAKEVSQRVTQEKYNVLWLHLNKKIEDEKSLYEILAAQLSIIYEFEEGEEPDELDYPLESLKEKIKEEMIKHKKDNLLLILDDEGSMTTEEDVMQELNLQDFLKEYSAVKILVTRRDEREEKESTTIKVGPLTEKESLDLLHDAEDLLTSFTSEDWPVLLKRLCDNKEIKEPTLMSCILSKSKGLPAAIVVLIKSLNSIKSMSAKQRKIFKELILSSKSLDEAAASKNAIDRSRYNPVLQLSYELLKPDETVKRPVIAC

Gene3D: G3DSA:3.40.50.300
24-140 no description

GVPSKTVLVGEAGIGKTWLAKEVSQRVTQEKYNVLWLHLNKKIEDEKSLYEILAAQLSIIYEFEEGEEPDELDYPLESLKEKIKEEMIKHKKDNLLLILDDEGSMTTEEDVMQELNL

FPrintScan: PR00364
IPR000767
28-43 DISEASERSIST
Disease resistance protein

KTVLVGEAGIGKTWLA

Seg: seg
80-102 seg

LSIIYEFEEGEEPDELDYPLESL

Seg: seg
103-115 seg

KEKIKEEMIKHKK

FPrintScan: PR00364
IPR000767
112-126 DISEASERSIST
Disease resistance protein

KHKKDNLLLILDDEG

FPrintScan: PR00364
IPR000767
223-237 DISEASERSIST
Disease resistance protein

SKGLPAAIVVLIKSL

superfamily: SSF52047
409-739 RNI-like,LRR

MIQTIQSKKKNITTIIASGNRLRREVHGKFFEKPEMQDLEVVVLFEPTFHELVLSLSKLKKLRVLVIRDCDLIDNIDKLSGLQGLHVLEVSGASSLVNIPDDFFKNMTQLQSLNLSGLAIKSSPSTIEKLSMLRCFILRHCSELQDLPNFIVETRKLEVIDIHGARKLESYFDRVKDWKDYKGKNKNFAQLQLLEHLDFSETKIIRLPIFHLKDSTNDFSTMPILTRLLLRNCTRLKRLPQLRPLTNLQILDACGATDLVEMLEVCLEEKKELRILDMSKTSLPELADTIADVVNLNKLLLRNCSLIEELPSIEKLTHLEVFDVSGCIKLK

Gene3D: G3DSA:3.80.10.10
417-572 no description

KKNITTIIASGNRLRREVHGKFFEKPEMQDLEVVVLFEPTFHELVLSLSKLKKLRVLVIRDCDLIDNIDKLSGLQGLHVLEVSGASSLVNIPDDFFKNMTQLQSLNLSGLAIKSSPSTIEKLSMLRCFILRHCSELQDLPNFIVETRKLEVIDIHG

Seg: seg
460-474 seg

LVLSLSKLKKLRVLV

HMMPfam: PF13855
493-549 LRR_8,Leucine rich repeat

LHVLEVSGASSLVNIPDDFFKNMTQLQSLNLSGLAIKSSPSTIEKLSMLRCFILRHC

Gene3D: G3DSA:3.80.10.10
593-794 no description

NKNFAQLQLLEHLDFSETKIIRLPIFHLKDSTNDFSTMPILTRLLLRNCTRLKRLPQLRPLTNLQILDACGATDLVEMLEVCLEEKKELRILDMSKTSLPELADTIADVVNLNKLLLRNCSLIEELPSIEKLTHLEVFDVSGCIKLKNINGSFGEMSYLHEVNLSETNLSELPDKISELSNLKELIIRKCSKLKTLPNLEKL

Seg: seg
633-647 seg

LTRLLLRNCTRLKRL

superfamily: SSF52058
679-1138 L domain-like,LRR

KELRILDMSKTSLPELADTIADVVNLNKLLLRNCSLIEELPSIEKLTHLEVFDVSGCIKLKNINGSFGEMSYLHEVNLSETNLSELPDKISELSNLKELIIRKCSKLKTLPNLEKLTNLEIFDVSGCTELETIEGSFENLSCLHKVNLSETNLGELPNKISELSNLKELILRNCSKLKALPNLEKLTHLVIFDVSGCTNLDKIEESFESMSYLCESILCSSKRIVLADSSCIERDQWSQIKECLTSKSEGSSFSNVGEKTREKLLYHGNRYRVIDPEVPLNIDIVDIKRSTDLKTEYIAKAEYVSIAENGSKSVSSLFDELQMASVKGCWVERCKNMDVLFESDEQLEKEKSSSPSLQTLWISNLPLLTSLYSSKGGFIFKNLKKLSVDCCPSIKWLFPEIPDNLEILRVKFCDKLERLFEVKAGELSKLRKLHLLDLPVLSVLGANFPNLEKCTIEKCP

Gene3D: G3DSA:3.80.10.10
795-891 no description

TNLEIFDVSGCTELETIEGSFENLSCLHKVNLSETNLGELPNKISELSNLKELILRNCSKLKALPNLEKLTHLVIFDVSGCTNLDKIEESFESMSYL

FPrintScan: PR00364
IPR000767
839-855 DISEASERSIST
Disease resistance protein

SELSNLKELILRNCSKL

Gene3D: G3DSA:3.80.10.10
1011-1140 no description

RCKNMDVLFESDEQLEKEKSSSPSLQTLWISNLPLLTSLYSSKGGFIFKNLKKLSVDCCPSIKWLFPEIPDNLEILRVKFCDKLERLFEVKAGELSKLRKLHLLDLPVLSVLGANFPNLEKCTIEKCPKL

Seg: seg
1105-1122 seg

LSKLRKLHLLDLPVLSVL

HMMPanther: PTHR22599
IPR005301
1150-1402 FAMILY NOT NAMED
Mob1/phocein

GARITDEISEDQPHKNTIGPETQTPTQPTKATDTIFRIVIPDWNLMEPINQKTFRPKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQELIESII

HMMPanther: PTHR22599:SF8
1150-1402 MPS ONE BINDER KINASE ACTIVATOR-LIKE 1 (MOB1 HOMOLOG 1) (MOB1),MPS ONE BINDER KINASE ACTIVATOR-LIKE 1 (MOB1 HOMOLOG 1) (MOB1)

GARITDEISEDQPHKNTIGPETQTPTQPTKATDTIFRIVIPDWNLMEPINQKTFRPKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQELIESII

superfamily: SSF101152
IPR005301
1205-1405 Mob1/phocein
Mob1/phocein

PKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQELIESIIAPY

HMMPfam: PF03637
IPR005301
1220-1395 Mob1_phocein
Mob1/phocein

KHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQ

Gene3D: G3DSA:1.20.140.30
IPR005301
1224-1402 no description
Mob1/phocein

ATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQELIESII






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox