PRGDB00049564 (Os12g0586000)

From PRG Wiki
Jump to: navigation, search
Os12g0586000
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115489333 (NM_001073686)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0586000 (Os12g0586000) mRNA, complete cds.

DNA Sequence

ATGATCATCTGCTACTTCAGCGATAGAGTCTTCTTTGAGACGATCTCGCAGTCCGCAAATCTGGACACTATCAAGATGAAGCTATGGGAGCAGATCAGTGGAAACCTTGTGCTCGGTGCGTACAACCAGATCCCAGAATGGCAACTCAAGTTGGGGCCAAGGGACAAAGGACCTGTTCTTGTTATCCTTGATGATGTCTGGTCTCTCTCACAGCTAGAGGAGCTCATCTTCAAGTTCCCTGGGTGCAAGACACTTGTAGTATCAAGGTTCAAGTTCCCCTCGTTGGTCACCCGGACTTACGAAATGGAGTTGCTCGATGAGGAGGCGGCTCTTTCTGTCTTCTGTCGTGCTGCCTTTGATCAGGAGTCCGTTCCTCGGACCGCTGACAAGAAACTGGTTCGGCAGGTTGCTGCAGAGTGCAGAGGACTTCCTCTAGCACTGAAGGTTATCGGTGCGTCGTTGCGGGATCAGCCTCCTAAGATATGGTTGAGTGCGAAGAACCGGTTGTCGCGAGGAGAGACTATATCTGACTCTCATGAGACCAAACTCCTGGAGAGGATGGCCGCAAGCATCGAGTGCTTGTCAGGGAAGGTTAGAGAATGTTTCCTTGATCTGGGTTGCTTTCCGGAGGATAAGAAGATCCCACTGGATGTGTTGATCAATATATGGATGGAGATTCATGATCTTGATGAGCCGGATGCCTTCGCCATCTTGGTTGAGCTATCAAACAAGAATCTTCTCACCCTAGTTAATGATGCACAGAACAAAGCCGGCGATTTGTACAGCAGCTACCATGACTTCTCGGTTACACAACATGATGTATTGAGGGATCTAGCGCTTCACATGAGTGGTCGTGATGCTCTGAACAACCGGAGACGGCTGGTGATGCCAAGAAGAGAAGAATCACTACCGAAGGATTGGCAGAGGAATAAGGACACTCCGTTCGAAGCTCAGATAGTTTCCATTCATACAGGTGAGATGAAAGAATCTGACTGGTTCCAGATGAGCTTCCCCAAGGCCGAAGTGCTTATCCTCAACTTCGCGTCAAGTGTATACTATCTCCCACCATTCATTGCAACCATGCAGAACTTGAAAGCCCTGGTGCTGATCAACTATGGCACCATCAGTGCAACCCTTGATAACCTATCCGCCTTCACCACGCTCAGTGACCTGAGGAGCCTTTGGCTTGAGAAGATCACACTTCCACCGCTACCAAAAACCACAATCCCACTGAAGAACCTGCGCAAGATATCCCTTGTCCTCTGTGAGCTGACCAACAGTCTGAGAGGATCAAAGGTGGATCTCTCGATGACATTCCCGCGCCTATCCAACCTCACCATTGACCACTGCATAGACCTGAAGGAGCTACCATCTAGCATATGTGAAATCAGTTCCCTGGAGAGCATCTCCATCTCAAACTGCCATGACCTCACAGAGCTTCCATATGAGCTGGGCAAGCTGCATTGCCTGAGCATCCTAAGGGTATACGCCTGCCCGGCTCTGTGGCGGCTCCCGCCTTCGGTATGCAGCCTGAAGAGGCTGAAATACCTCGACATTTCGCAGTGTGTCAACCTGACGGACCTCCCTGAGGAGCTCGGTCACCTGACAAGCCTGGAGAAGATCGACATGCGAGAATGCTCGCGACTGAGGAGCCTCCCGAGGTCGTCCTCATCGCTCAAGTCCCTCGGGCACGTCGTGTGCGACGAGGAGACGGCGTTGCTGTGGAGGGAAGCTGAGCAGGTCATCCCAGACCTCCGGGTTCAGGTAGCAGAAGAGTGTTATAACCTGGACTGGCTTGTAGACTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0586000 [Oryza sativa (japonica cultivar-group)].

MIICYFSDRVFFETISQSANLDTIKMKLWEQISGNLVLGAYNQIPEWQLKLGPRDKGPVLVILDDVWSLSQLEELIFKFPGCKTLVVSRFKFPSLVTRTYEMELLDEEAALSVFCRAAFDQESVPRTADKKLVRQVAAECRGLPLALKVIGASLRDQPPKIWLSAKNRLSRGETISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWMEIHDLDEPDAFAILVELSNKNLLTLVNDAQNKAGDLYSSYHDFSVTQHDVLRDLALHMSGRDALNNRRRLVMPRREESLPKDWQRNKDTPFEAQIVSIHTGEMKESDWFQMSFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTISATLDNLSAFTTLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELTNSLRGSKVDLSMTFPRLSNLTIDHCIDLKELPSSICEISSLESISISNCHDLTELPYELGKLHCLSILRVYACPALWRLPPSVCSLKRLKYLDISQCVNLTDLPEELGHLTSLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDEETALLWREAEQVIPDLRVQVAEECYNLDWLVD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-592 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IICYFSDRVFFETISQSANLDTIKMKLWEQISGNLVLGAYNQIPEWQLKLGPRDKGPVLVILDDVWSLSQLEELIFKFPGCKTLVVSRFKFPSLVTRTYEMELLDEEAALSVFCRAAFDQESVPRTADKKLVRQVAAECRGLPLALKVIGASLRDQPPKIWLSAKNRLSRGETISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWMEIHDLDEPDAFAILVELSNKNLLTLVNDAQNKAGDLYSSYHDFSVTQHDVLRDLALHMSGRDALNNRRRLVMPRREESLPKDWQRNKDTPFEAQIVSIHTGEMKESDWFQMSFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTISATLDNLSAFTTLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELTNSLRGSKVDLSMTFPRLSNLTIDHCIDLKELPSSICEISSLESISISNCHDLTELPYELGKLHCLSILRVYACPALWRLPPSVCSLKRLKYLDISQCVNLTDLPEELGHLTSLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDEETALLWREAEQVIPDLRVQVAEE

HMMPanther: PTHR23155:SF282
2-592 PTHR23155:SF282,SUBFAMILY NOT NAMED

IICYFSDRVFFETISQSANLDTIKMKLWEQISGNLVLGAYNQIPEWQLKLGPRDKGPVLVILDDVWSLSQLEELIFKFPGCKTLVVSRFKFPSLVTRTYEMELLDEEAALSVFCRAAFDQESVPRTADKKLVRQVAAECRGLPLALKVIGASLRDQPPKIWLSAKNRLSRGETISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWMEIHDLDEPDAFAILVELSNKNLLTLVNDAQNKAGDLYSSYHDFSVTQHDVLRDLALHMSGRDALNNRRRLVMPRREESLPKDWQRNKDTPFEAQIVSIHTGEMKESDWFQMSFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTISATLDNLSAFTTLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELTNSLRGSKVDLSMTFPRLSNLTIDHCIDLKELPSSICEISSLESISISNCHDLTELPYELGKLHCLSILRVYACPALWRLPPSVCSLKRLKYLDISQCVNLTDLPEELGHLTSLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDEETALLWREAEQVIPDLRVQVAEE

FPrintScan: PR00364
IPR000767
53-67 DISEASERSIST
Disease resistance protein

PRDKGPVLVILDDVW

HMMPfam: PF00931
IPR002182
55-225 NB-ARC,NBS
NB-ARC

DKGPVLVILDDVWSLSQLEELIFKFPGCKTLVVSRFKFPSLVTRTYEMELLDEEAALSVFCRAAFDQESVPRTADKKLVRQVAAECRGLPLALKVIGASLRDQPPKIWLSAKNRLSRGETISDSHETKLLERMAASIECLSGKVRECFLDLGCFPEDKKIPLDVLINIWME

FPrintScan: PR00364
IPR000767
140-154 DISEASERSIST
Disease resistance protein

CRGLPLALKVIGASL

superfamily: SSF52058
230-569 SSF52058,LRR

DEPDAFAILVELSNKNLLTLVNDAQNKAGDLYSSYHDFSVTQHDVLRDLALHMSGRDALNNRRRLVMPRREESLPKDWQRNKDTPFEAQIVSIHTGEMKESDWFQMSFPKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTISATLDNLSAFTTLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELTNSLRGSKVDLSMTFPRLSNLTIDHCIDLKELPSSICEISSLESISISNCHDLTELPYELGKLHCLSILRVYACPALWRLPPSVCSLKRLKYLDISQCVNLTDLPEELGHLTSLEKIDMRECSRLRSLPRSSSSLKSLGHVVCDE

Gene3D: G3DSA:3.80.10.10
338-563 G3DSA:3.80.10.10

PKAEVLILNFASSVYYLPPFIATMQNLKALVLINYGTISATLDNLSAFTTLSDLRSLWLEKITLPPLPKTTIPLKNLRKISLVLCELTNSLRGSKVDLSMTFPRLSNLTIDHCIDLKELPSSICEISSLESISISNCHDLTELPYELGKLHCLSILRVYACPALWRLPPSVCSLKRLKYLDISQCVNLTDLPEELGHLTSLEKIDMRECSRLRSLPRSSSSLKSLG

HMMPfam: PF00560
IPR001611
465-487 LRR_1
Leucine-rich repeat

SLESISISNCHDLTELPYELGKL

FPrintScan: PR00364
IPR000767
509-525 DISEASERSIST
Disease resistance protein

CSLKRLKYLDISQCVNL

HMMPfam: PF00560
IPR001611
513-535 LRR_1
Leucine-rich repeat

RLKYLDISQCVNLTDLPEELGHL


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox