PRGDB00049571 (disease resistance-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 24459852 (AJ298890)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Coffea arabica

Comment?

Coffea arabica partial ORF for disease resistance-like protein, clone NBS ArgaF1.

DNA Sequence

TGGTGTCGGGAAAACCACTCTAGCCAAAAAAGTTTATAACCATGCTGGCGTCAGGGGAACATTCAACTGCCGTGCTTGGGTGTGCGTCTCTTCAAGCTACAATCACAAAGAGAGGCTGAGGACAATCATAAAGCAATTAAATCCGATAACTAATGAGCTACTTGACATGTTGGAAAAGATGGACGAGCAGGACTTGGAAGAAAGGCTGTATAAAGATCTACAAGACAAATGTTATCTTGTGGTGCTTGATGATGTATGGGAGGTAGCAGCGTGGGATTGTCTTGCCAGGAGGGCCTTTCCTGATGTTGGCACATCAAGTAGAGTGCTACTTACAAGTCGCAAACGGGATGTCGCCCAACACGCTGATGCTTATAGACACCCGTATGAGTTGAAAACTTTGGGGCAGGAAGACAGCTGGCAGTTGTTCCTCAGAAAGGCATTAGGCCATGGAGCTAATGCTGGGTGTCCTCCGGATTTGGAAGAAGTAGGCAGAGAGATTGCAAGGAGATGTGGCGGACTCCCACTCGCCCT


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Coffea arabica].

GVGKTTLAKKVYNHAGVRGTFNCRAWVCVSSSYNHKERLRTIIKQLNPITNELLDMLEKMDEQDLEERLYKDLQDKCYLVVLDDVWEVAAWDCLARRAFPDVGTSSRVLLTSRKRDVAQHADAYRHPYELKTLGQEDSWQLFLRKALGHGANAGCPPDLEEVGREIARRCGGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-177 PTHR11017:SF20,SUBFAMILY NOT NAMED

GVGKTTLAKKVYNHAGVRGTFNCRAWVCVSSSYNHKERLRTIIKQLNPITNELLDMLEKMDEQDLEERLYKDLQDKCYLVVLDDVWEVAAWDCLARRAFPDVGTSSRVLLTSRKRDVAQHADAYRHPYELKTLGQEDSWQLFLRKALGHGANAGCPPDLEEVGREIARRCGGLPLAL

HMMPfam: PF00931
IPR002182
1-177 NB-ARC,NBS
NB-ARC

GVGKTTLAKKVYNHAGVRGTFNCRAWVCVSSSYNHKERLRTIIKQLNPITNELLDMLEKMDEQDLEERLYKDLQDKCYLVVLDDVWEVAAWDCLARRAFPDVGTSSRVLLTSRKRDVAQHADAYRHPYELKTLGQEDSWQLFLRKALGHGANAGCPPDLEEVGREIARRCGGLPLAL

HMMPanther: PTHR11017
1-177 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTLAKKVYNHAGVRGTFNCRAWVCVSSSYNHKERLRTIIKQLNPITNELLDMLEKMDEQDLEERLYKDLQDKCYLVVLDDVWEVAAWDCLARRAFPDVGTSSRVLLTSRKRDVAQHADAYRHPYELKTLGQEDSWQLFLRKALGHGANAGCPPDLEEVGREIARRCGGLPLAL

superfamily: SSF52540
1-177 SSF52540

GVGKTTLAKKVYNHAGVRGTFNCRAWVCVSSSYNHKERLRTIIKQLNPITNELLDMLEKMDEQDLEERLYKDLQDKCYLVVLDDVWEVAAWDCLARRAFPDVGTSSRVLLTSRKRDVAQHADAYRHPYELKTLGQEDSWQLFLRKALGHGANAGCPPDLEEVGREIARRCGGLPLAL

FPrintScan: PR00364
IPR000767
72-86 DISEASERSIST
Disease resistance protein

DLQDKCYLVVLDDVW

FPrintScan: PR00364
IPR000767
170-177 DISEASERSIST
Disease resistance protein

CGGLPLAL


List of References

S Noir, M C Combes, F Anthony, P Lashermes
Origin, diversity and evolution of NBS-type disease-resistance gene homologues in coffee trees (Coffea L.).
Mol. Genet. Genomics: 2001, 265(4);654-62
PubMed:11459185 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox