PRGDB00049580 (60I2G15)

From PRG Wiki
Jump to: navigation, search
60I2G15
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644186 (AJ416708)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Populus deltoides

Comment?

Populus deltoides MER locus, genomic DNA, cultivar S9-2.

DNA Sequence

GCAATTTGCAATGGTCGTCACCGGTATTGTATTCACGGCATTCCTGGTGGTAACATGCCAAATTGGATGAGCTACAGTGGAGAAGGATGCTCATTGTCATTCCATATACCTCCAGTCTTCCATGGCTTAGTTCGTTGGTTTGTCTTTCGACCACTTGAGATGGATGTTCGTTATTACTTCCACACTAACATTATTAGTATTATAAGAAATAAAAGCAATGGTATTCAATTGTTTAAAGATAAACAAATAGCAGGAGCTGGGGGCTGGATAAGATACATAAGTAGAAGTGAAATGGCAATGGAAGATTACTGTGGAGATGACGAATTGGAACTATACATTTCTTCAGTGCCATCACTGGATGCGGTGTACAACGGTTTGCAAGTCAAACCCGTACACGTTAAAGAATGTGGGGTCCATGTGATCGCAGGGAAGTTAGATTCATTTGAAGAGTCGGCGGTGGGAAGAGATACAATAATGTCTTCACCGTCCCTGTATCATCTGCTTCCTCATCCCCATTGTGGTTCAATTATAGCGTCTACACCTAAGCAATGGAGTGACTTTTTATTTCCAAATATGCAAGAACTTTCCTTCAATATATGGATTTATGGTAAGAACAAATATTTCTTTTAGTTTAGAAAAACTAAACCTGAAAGGTTGCTCGAGTTTAGTTGAGGTGCATCAATCTATTGGAAATTTGACGAGCCTTGATTTCTTGAATCTGGAGGGATGTTGGAGGCTGAAGAATCTCCCTGAAAGCATTGGTAATGTAAAGTCTCTTGAAACTCTGAATATTTCTGGGTGTTCACAACTTGAGAAATTGCCAGAAAGCATGGGTGATATGGAATCCTTAATCGAATTGCTAGCCGATGGGATTGAAAATGAGCAATTTCTCTCTTCAATTGGACAATTAAAGCATGTCAGAAGGTTATCATTGCGTGGATACAGTTCGACTCCACCAAGTTCTTCTTTGATTTCAGCAGGTGTTTTGAATTTGAAACGTTGGCTGCCAACATCTTTCATTCAATGGATATCAGTGAAACGTCTTGAGCTTCCTCATGGTGGTTTGTCTGATCGCGCAGCTAAGTGTGTTGATTTCAGTGGTTTGTCCGCTCTAGAAGTATTGGATCTAATAGGAAACAAATTCTCTAGCTTGCCTTCTGGGATCGGCTTCCTTTCCAAGCTAAAGTTCTTGTCTGTAAAGGCATGCAAATATCTTGTATCAATCCCAGATCTTCCCTCAAGTTTAGACTGTTTGGATGCATCTTATTGCAAATCATTGGAAAGAGTAAGAATACCAATCGAGCCAAAAAAAGAACTAGATATAAATCTATATAAAAGTCATTCGTTAGAAGAGATTCAGGGCATCGAAGGTCTAAGTAATAATATCTGGAGTTTAGAAGTTGATACCAGCAGGCATTCACCAAATAAATTACAGAAGAGCGTTGTTGAGGGTACGGATGTTGTAAAGGGTCTTGCACTGGATGTCAGAGCATCAGAAGCTAAATCACTTAGCGCAGGATCATTTGCAGAAATGAAATGCTTAAATTTACTCCAAATCAATGGAGTACATCTCACCGGATCCTTAAAACTGTTTTCTAAAGAGTTGATGTGGATTTGTTGGCATGAATGTCCTTTGAAATATTTGCCATTTGATTTTACATTGGACAATCTAGCTGTTCTTGATATGCAGTACAGTAACCTCAAAGAACTATGGAAGGGAAAAAAGGTGCGAAACATGCTACAATCCCCAAAATTTCTCCAGTATGTAATTTATATTTACATGCATGAAGCAAAATTTATCAAAGAGATTATCAAGGTTGTGTTGAATAAATTAGAACCCAAGTACTTATATGTTCCTGAGCACCTAGTAGGTATGGATCAGCTTGCTCGCAATATTTTTGACTTTCTAAGTGCTGCAACAGATGATGTACGCATTGTGGGCATACATGGGATGCCAGGAATAGGAAAGACAACTATAGCACAAGCTGTATTTAATCAACTCTGCTATGGATTCGAGGGAAGCTGTTTTCTTTCGAGTATCAATGAAAGGTCAAAACAAGTTAATGGTCTTGTTCCTTTACAAAAGCAACTTCATCACGATATTTTAAAACAGGATGTTGCAAACTTCGATTGTGCTGATAGAGGAAAGGTTCTGATCAAAGAGCGACTTCGTCGCAAAAGAGTTCTTGTTGTTGCTGATGATGTGGCGCATCTGGAACAGCTGAATGCATTGATGGGAGATCGAAGTTGGTTTGGTCCCGGAAGTAGAGTAATTATTACAACAAGAGATTCAAATCTTCTTCGTGAAGCAGATCAAATATATCAGATCGAAGAATTGAAACCAGATGAGTCCCTTCAGCTTTTCAGCAGGCATGCCTTTAAGGACTCCAAGCCAGCACAAGACTATATTGAGCTTTCGAAGAAAGCCGTTGGTTACTGTGGAGGACTTCCTTTAGCTCTTGAGGTTATAGGAGCTCTTCTGTACAGGAAAAACAGAGGTAGATGCGTAAGTGAAATTGACAACTTGAGCAGAATTCCAAACCAAGATATTCAAGGAAAGCTTCTAATAAGTTATCACGCACTTGATGGTGAACTACAAAGAGCATTCCTTGATATTGCATGCTTCTTTATTGGTATAGAGAGAGAATACGTCACAAAAGTGCTAGGAGCCCGTTGCCGTCCCAATCCAGAAGTTGTTTTGGAAACTCTCAGTGAAAGGTCTCTGATTCAAGTATTTGGAGAGACGGTAAGCATGCATGATCTATTACGAGACATGGGAAGGGAGGTCGTTTGTAAAGCGTCTCCCAAACAACCTGGAAAGAGGACCAGAATTTGGAATCAAGAGGATGCATGGAATGTACTTGAGCAGCAGAAGGTAAGAAGCCAGAGTCTTCTCGATCTAGACCAGAAGGGGCCTATGATGTCTTCTTGAGTTTTAGAGGAGAAGACACTCGCAAGACATTTACAGATCATCTATATACTGCCTTGGTCCAAGCAGGAATCCACACTTTTCGAGATGATGATGAACTTCCGAGGGGAGAAGAAATCTCCGATCATTTCCTCAGGGCAATTCAAGAATCAAAGATATCCATAGCTGTCTTCTCAAAAGGATATGCTTCTTCTAGATGGTGTCTCAATGAACTTGTAGAGATTCTTAAGTGCAAAAAAAGGAAAACCGGTCAGATTGTTCTTCCTATATTCTATGACATTGATCCTTCAGATGTGAGAAAACAGAATGGCAGTTTTGCAGAAGCATTTGTTAAACATGAAGAGCGTTTTGAAGAGAAGTTGGTGAAGGAGTGGAGAAAAGCTCTTGAGGAGGCTGGAAATCTATCTGGATGGAATCTCAATGATATGGCAAATGGATGCAGAAAGAAAAACGCAAGCAATCCAAAGATGAAGAAAACGATCCATCCTCGCGAAAGAGAAGAAAAGCTGACCTCA


Protein sequences

Name Description Sequence
TIR/NBS/LRR protein TIR/NBS/LRR protein [Populus deltoides].

MQKEKRKQSKDEENDPSSRKRRKADLKPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSGWNLNDMANGHEAKFIKEIIKVVLNKLEPKYLYVPEHLVGMDQLARNIFDFLSAATDDVRIVGIHGMPGIGKTTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPDESLQLFSRHAFKDSKPAQDYIELSKKAVGYCGGLPLALEVIGALLYRKNRGRCVSEIDNLSRIPNQDIQGKLLISYHALDGELQRAFLDIACFFIGIEREYVTKVLGARCRPNPEVVLETLSERSLIQVFGETVSMHDLLRDMGREVVCKASPKQPGKRTRIWNQEDAWNVLEQQKVRGTDVVKGLALDVRASEAKSLSAGSFAEMKCLNLLQINGVHLTGSLKLFSKELMWICWHECPLKYLPFDFTLDNLAVLDMQYSNLKELWKGKKVRNMLQSPKFLQYVIYIYILEKLNLKGCSSLVEVHQSIGNLTSLDFLNLEGCWRLKNLPESIGNVKSLETLNISGCSQLEKLPESMGDMESLIELLADGIENEQFLSSIGQLKHVRRLSLRGYSSTPPSSSLISAGVLNLKRWLPTSFIQWISVKRLELPHGGLSDRAAKCVDFSGLSALEVLDLIGNKFSSLPSGIGFLSKLKFLSVKACKYLVSIPDLPSSLDCLDASYCKSLERVRIPIEPKKELDINLYKSHSLEEIQGIEGLSNNIWSLEVDTSRHSPNKLQKSVVEAICNGRHRYCIHGIPGGNMPNWMSYSGEGCSLSFHIPPVFHGLVRWFVFRPLEMDVRYYFHTNIISIIRNKSNGIQLFKDKQIAGAGGWIRYISRSEMAMEDYCGDDELELYISSVPSLDAVYNGLQVKPVHVKECGVHVIAGKLDSFEESAVGRDTIMSSPSLYHLLPHPHCGSIIASTPKQWSDFLFPNMQELSFNIWIYGKNKYFF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
27-180 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSGW

ProfileScan: PS50104
IPR000157
37-177 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNL

HMMSmart: SM00255
IPR000157
38-177 TIR
Toll/interleukin-1 receptor homology (TIR) domain

AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNL

Gene3D: G3DSA:3.40.50.10140
38-169 G3DSA:3.40.50.10140

AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRK

HMMPfam: PF01582
IPR000157
41-172 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALE

HMMPanther: PTHR11017
65-889 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSGWNLNDMANGHEAKFIKEIIKVVLNKLEPKYLYVPEHLVGMDQLARNIFDFLSAATDDVRIVGIHGMPGIGKTTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPDESLQLFSRHAFKDSKPAQDYIELSKKAVGYCGGLPLALEVIGALLYRKNRGRCVSEIDNLSRIPNQDIQGKLLISYHALDGELQRAFLDIACFFIGIEREYVTKVLGARCRPNPEVVLETLSERSLIQVFGETVSMHDLLRDMGREVVCKASPKQPGKRTRIWNQEDAWNVLEQQKVRGTDVVKGLALDVRASEAKSLSAGSFAEMKCLNLLQINGVHLTGSLKLFSKELMWICWHECPLKYLPFDFTLDNLAVLDMQYSNLKELWKGKKVRNMLQSPKFLQYVIYIYILEKLNLKGCSSLVEVHQSIGNLTSLDFLNLEGCWRLKNLPESIGNVKSLETLNISGCSQLEKLPESMGDMESLIELLADGIENEQFLSSIGQLKHVRRLSLRGYSSTPPSSSLISAGVLNLKRWLPTSFIQWISVKRLELPHGGLSDRAAKCVDFSGLSALEVLDLIGNKFSSLPSGIGFLSKLKFLSVKACKYLVSIPDLPSSLDCLDASYCKSLERVRIPIE

HMMPanther: PTHR11017:SF20
65-889 PTHR11017:SF20,SUBFAMILY NOT NAMED

AGIHTFRDDDELPRGEEISDHFLRAIQESKISIAVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSGWNLNDMANGHEAKFIKEIIKVVLNKLEPKYLYVPEHLVGMDQLARNIFDFLSAATDDVRIVGIHGMPGIGKTTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPDESLQLFSRHAFKDSKPAQDYIELSKKAVGYCGGLPLALEVIGALLYRKNRGRCVSEIDNLSRIPNQDIQGKLLISYHALDGELQRAFLDIACFFIGIEREYVTKVLGARCRPNPEVVLETLSERSLIQVFGETVSMHDLLRDMGREVVCKASPKQPGKRTRIWNQEDAWNVLEQQKVRGTDVVKGLALDVRASEAKSLSAGSFAEMKCLNLLQINGVHLTGSLKLFSKELMWICWHECPLKYLPFDFTLDNLAVLDMQYSNLKELWKGKKVRNMLQSPKFLQYVIYIYILEKLNLKGCSSLVEVHQSIGNLTSLDFLNLEGCWRLKNLPESIGNVKSLETLNISGCSQLEKLPESMGDMESLIELLADGIENEQFLSSIGQLKHVRRLSLRGYSSTPPSSSLISAGVLNLKRWLPTSFIQWISVKRLELPHGGLSDRAAKCVDFSGLSALEVLDLIGNKFSSLPSGIGFLSKLKFLSVKACKYLVSIPDLPSSLDCLDASYCKSLERVRIPIE

superfamily: SSF52540
199-444 SSF52540

KVVLNKLEPKYLYVPEHLVGMDQLARNIFDFLSAATDDVRIVGIHGMPGIGKTTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPDESLQLFSRHAFKDSKPAQDYIELSKKAVGYCGGLPLALEVIGALLYRKNRGRCVSEIDNLSRIPNQDI

Gene3D: G3DSA:3.40.50.300
213-250 G3DSA:3.40.50.300

PEHLVGMDQLARNIFDFLSAATDDVRIVGIHGMPGIGK

HMMPfam: PF00931
IPR002182
222-474 NB-ARC,NBS
NB-ARC

LARNIFDFLSAATDDVRIVGIHGMPGIGKTTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPDESLQLFSRHAFKDSKPAQDYIELSKKAVGYCGGLPLALEVIGALLYRKNRGRCVSEIDNLSRIPNQDIQGKLLISYHALDGELQRAFLDIACFFIGIE

HMMSmart: SM00382
IPR003593
236-376 AAA,NBS
AAA+ ATPase domain

DVRIVGIHGMPGIGKTTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPD

FPrintScan: PR00364
IPR000767
239-254 DISEASERSIST
Disease resistance protein

IVGIHGMPGIGKTTIA

Gene3D: G3DSA:3.40.50.300
251-384 G3DSA:3.40.50.300

TTIAQAVFNQLCYGFEGSCFLSSINERSKQVNGLVPLQKQLHHDILKQDVANFDCADRGKVLIKERLRRKRVLVVADDVAHLEQLNALMGDRSWFGPGSRVIITTRDSNLLREADQIYQIEELKPDESLQLFSR

FPrintScan: PR00364
IPR000767
316-330 DISEASERSIST
Disease resistance protein

RLRRKRVLVVADDVA

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

CGGLPLALEVIGALL

superfamily: SSF46785
442-549 SSF46785

QDIQGKLLISYHALDGELQRAFLDIACFFIGIEREYVTKVLGARCRPNPEVVLETLSERSLIQVFGETVSMHDLLRDMGREVVCKASPKQPGKRTRIWNQEDAWNVLE

superfamily: SSF52058
523-913 SSF52058,LRR

VVCKASPKQPGKRTRIWNQEDAWNVLEQQKVRGTDVVKGLALDVRASEAKSLSAGSFAEMKCLNLLQINGVHLTGSLKLFSKELMWICWHECPLKYLPFDFTLDNLAVLDMQYSNLKELWKGKKVRNMLQSPKFLQYVIYIYILEKLNLKGCSSLVEVHQSIGNLTSLDFLNLEGCWRLKNLPESIGNVKSLETLNISGCSQLEKLPESMGDMESLIELLADGIENEQFLSSIGQLKHVRRLSLRGYSSTPPSSSLISAGVLNLKRWLPTSFIQWISVKRLELPHGGLSDRAAKCVDFSGLSALEVLDLIGNKFSSLPSGIGFLSKLKFLSVKACKYLVSIPDLPSSLDCLDASYCKSLERVRIPIEPKKELDINLYKSHSLEEIQGIEGL

Gene3D: G3DSA:3.80.10.10
563-770 G3DSA:3.80.10.10

ALDVRASEAKSLSAGSFAEMKCLNLLQINGVHLTGSLKLFSKELMWICWHECPLKYLPFDFTLDNLAVLDMQYSNLKELWKGKKVRNMLQSPKFLQYVIYIYILEKLNLKGCSSLVEVHQSIGNLTSLDFLNLEGCWRLKNLPESIGNVKSLETLNISGCSQLEKLPESMGDMESLIELLADGIENEQFLSSIGQLKHVRRLSLRGYS

HMMPfam: PF07725
IPR011713
627-646 LRR_3
Leucine-rich repeat 3

NLAVLDMQYSNLKELWKGKK

FPrintScan: PR00364
IPR000767
709-725 DISEASERSIST
Disease resistance protein

GNVKSLETLNISGCSQL

HMMPfam: PF00560
IPR001611
713-731 LRR_1
Leucine-rich repeat

SLETLNISGCSQLEKLPES

Gene3D: G3DSA:3.80.10.10
790-881 G3DSA:3.80.10.10

LPTSFIQWISVKRLELPHGGLSDRAAKCVDFSGLSALEVLDLIGNKFSSLPSGIGFLSKLKFLSVKACKYLVSIPDLPSSLDCLDASYCKSL

HMMSmart: SM00369
IPR003591
823-846 LRR_TYP
Leucine-rich repeat, typical subtype

LSALEVLDLIGNKFSSLPSGIGFL

HMMPfam: PF00560
IPR001611
826-844 LRR_1
Leucine-rich repeat

LEVLDLIGNKFSSLPSGIG


List of References

M Lescot, S Rombauts, J Zhang, S Aubourg, C Mathé, S Jansson, P Rouzé, W Boerjan
Annotation of a 95-kb Populus deltoides genomic sequence reveals a disease resistance gene cluster and novel class I and class II transposable elements.
Theor. Appl. Genet.: 2004, 109(1);10-22
PubMed:15085260 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox