PRGDB00049581 (60I2G15)

From PRG Wiki
Jump to: navigation, search
60I2G15
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644186 (AJ416708)
Gene Class TNL
Domain Type TIR, LRR
Gene Species Populus deltoides

Comment?

Populus deltoides MER locus, genomic DNA, cultivar S9-2.

DNA Sequence

GCATGAAGCAAAATTTATCCAAGGGATTATCAAGAATGTGTTGAACAGACCATGACAGAGCCAGAGTCTTCTCGATCTAGACCTGAAGGGACCTATGATGTCTTCTTGAGCTTTAGAGGAGAAGACACTCGCCACACATTTACAGATCATCTCTATACTGCCTTGATCCAAGCAGGAATCCACACTTTTCGAGATGATGATGAACTTCCGAGAGGAGAAGAAATCTCCGATCATCTCATCAGGGCAATTCAAGAATCAAAGATATCCATAGTTGTCTTCTCAAAAGGATATGCTTCTTCTAGATGGTGTCTCAATGAACTTGTAGAGATTCTTAAGTGCAAAAGGAAGAAAACTGGTCAGATTGTTCTTCCTATATTCTATGACATTGATCCTTCAGATGTGAGAAAACAGAATGGCAGTTTTGCAGAAGCATTTGTTAAACATGAAGAGCGTTTTGAAGAGAAGTTGGTGAAGGAGTGGAGAAAAGCTCTTGAGGAGGCTGGAAATCTATCTGGATGGAATCTCAATGATATGGCAAATGGATGCAGAAAGAAAAACGCAAGCAATCCAAAGATGAAGAAAACGATTCATCCTTGCGGAAGAGAAGAAAAGCTGACCTCAGTAAGCCTGTCAGTTTTGTCTCCACAG


Protein sequences

Name Description Sequence
TIR/NBS/LRR protein TIR/NBS/LRR protein [Populus deltoides].

MQKEKRKQSKDEENDSSLRKRRKADLSKPVSFVSTAMTEPESSRSRPEGTYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSGWNLNDMANGHEAKFIQGIIKNVLNR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
39-192 TIR
Toll/interleukin-1 receptor homology (TIR) domain

EPESSRSRPEGTYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSGW

Gene3D: G3DSA:3.40.50.10140
49-182 G3DSA:3.40.50.10140

GTYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKA

ProfileScan: PS50104
IPR000157
49-189 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GTYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNL

HMMSmart: SM00255
IPR000157
50-189 TIR
Toll/interleukin-1 receptor homology (TIR) domain

TYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNL

HMMPfam: PF01582
IPR000157
53-184 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALE

HMMPanther: PTHR23155
54-191 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSG

HMMPanther: PTHR23155:SF300
54-191 PTHR23155:SF300

FLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERFEEKLVKEWRKALEEAGNLSG


List of References

M Lescot, S Rombauts, J Zhang, S Aubourg, C Mathé, S Jansson, P Rouzé, W Boerjan
Annotation of a 95-kb Populus deltoides genomic sequence reveals a disease resistance gene cluster and novel class I and class II transposable elements.
Theor. Appl. Genet.: 2004, 109(1);10-22
PubMed:15085260 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox