PRGDB00049582 (EDR1)

From PRG Wiki
Jump to: navigation, search
EDR1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 78771846 (AY743662)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

Triticum aestivum EDR1 (EDR1) mRNA, complete cds, alternatively spliced.

DNA Sequence

ATGAAGATCCCGTTTGTGACCAAGTGGTCGCACCGATCCAGCGAGCCCGCGGGGCCGTCGAATTCGGCTGCAGCGCAGCAGCAGCAGCAGCAGCAGGCGCCGTCTCCTCCTCCTCCCGTGGCGTCGACAGAGGCGGCAGGGGATGAGTTCATTCTGCAGGAGGAAGAGTACCAGATGCAACTGGCGTTGGCGCTATCAGCGTCGGCGTCGGGCGCCGAGGGCGCTGGGGATCCCGACGGGGAGCAGATCAGAAAGGCGAAGCTGATGAGCCTCGGGAAGGGCCACCCGGTCACCAACAGCGATCGTGGCGGGGGAGACACCCCGGAGTCGCTCTCCCGCCGTTACAGGGACTATAACTTTCTTGATTACAATGAGAAAGTAATTGATGGATTCTACGACGTATTTGGCCTCTCTGCGGGATCATCTGGGCAGGGCAAAATACCTTCACTGGCAGAGCTTCAGATGAGCATTGGGGATCTTGGATATGAAGTAATTGTGGTTGACTATAAATTTGATAATGCTCTGCAGGAGATGAAGGAAGTAGCAGAATGCTGCCTGTTGGGCTGTCCTGACATTACAGTATTGGTGCGACGAATAGCTGAAGTTGTTGCAGATCACATGGGTGGTCCAGTGATCGATGCAAATGAAATGATCACTAGGTGGTTGAGCAAAAGCATTGAGCAGAGGACATCACACCAGACAAGCCTTCTGCATATTGGCAGTATAGAGATAGGCTTGTCTCGCCATCGTGCCTTACTTTTCAAGATTCTTGCTGATATTGTTGGTATCCCTTGCAAGCTGGTTAAAGGGAGTCATTACACTGGTGTTGAAGATGACGCTATTAACATAATAAAGATGGATGACAAAAGGGAGTTTTTGGTGGATGTTATGGCTGCTCCAGGGACTCTCATTCCAGCAGATGTCTTTAATTCAAAGGGTACTCCATTCAACTTCAGTCAAACATTGGGTCAGAATCAGGTGGTGGAGTCAGCAAGTAACATCGAAGATGACCCAGTTGCATTACAGTCAGAGCATAAACGTAACCAAGGGCATATGTTTGCCAATAATAATCGGATCTCAGTCAATCTATCAAGCTATGAGAATACAATGACCGCTGGAAGTAGTGCTAGTGAACCTGGGACATTGGACCCTAGGATGCAATTAGGTAAAACATCAACTTTGCCTAGTGCTCCTTCCAAGCAGAAGAAGAATCTGCAATTGATTACAGACTCTCATGAAACTGAAGAGTCCCGAAAACTATTTGTGGAGTTAGATCCTTTCAATGCTATTGAATCTGGGAAAAGCTCATTGGCATTCAAGGGATTAAATAATAGAAACAATGAATTCCAAAGGCGTAGAGAGAATGTAGTCCCACCATCTGTAAGATCTCAACAGCCATTGGTGATGAAAAACTGGTCTGCTTGCAATGACATTTCCAACAACAAGCAATACAATGTTGCTGATGGGTCAGTTCCTCGGAGAAATGCCACTGACAATGCATCGTCATCTCAGTTGGCGTTGTCAACTGCAAAGCATTACAATTCCAATGTTAGAGAGCTAAACGATAGAGTGTATGCAGCACCTGCTCGTAATTATGACAACAAGATAGTTGGTACCTCGGCTATGGCCAAAGCATTGACTGGAGAGTGCCCTGACAGATCACAGGTGCCACCTGGTCTTTATTATGACAAGATGCTTGGTACCTCTTCTATGAATGCAGCTTCTACATCCGGAATCGGGAAAGTTGCAGAAAAGGACCCTCATAATGATCCGGGAAAAGGTCCCATCTATTCTAGATTTGATGGTGAACTTTCTAAAAATGCTCAAGGATTTACTCCCGAAAGGGATGAGCACAAGGAAAATTGTGGCAGTCATGACCACAAAATGTTATATCCTGATCCAAGAAAGTCCCCTCTTGACAGATTCATGGACAGGCCAAGGCAGAGCATAGAATGTGTTTTTCCATCCCAAGTTGGATCAAATAAGGCTGACATGGTGTTGGATGAAGTGTCTGAATGTGAAATCCTTTGGGAAGATCTTGTAATCGATGAAAGAATTGGCATAGGTTCATATGGAGAAGTCTACCATGCTGATTGGAATGGAACTGAAGTAGCTGTAAAGAAGTTCTTGGATCAAGAGTTCTATGGTGATGCTTTAGAGGAATTTCGTTGTGAAGTGAGGATTATGCGTCGGCTCCGTCATCCAAATATTGTTCTCTTTATGGGTGCAGTAACACGGCCTCCACACTTATCTATTGTATCAGAATATCTTCCAAGGGGAAGCTTATATAAGATCATTCATCGCCCTAATTGCCAAATCGACGAGAAGCGTAGGATTAAAATGGCCCTTGATGTGGCCAGAGGCATGAATTGTCTTCATACCAGTGTACCAACAATTGTTCACCGGGATCTAAAATCACCAAACTTGCTGGTTGACGATAATTGGACTGTGAAGGTCTGTGATTTCGGACTTTCACGTCTGAAGCACAGTACATTTTTGTCATCAAAATCCACTGCCGGGACTCCTGAGTGGATGGCACCAGAGGTTTTGCGGAATGAGCAATCCAATGAGAAGTGTGATATTTACAGCTTTGGTGTTATCCTGTGGGAGCTAGCAACACTAAGAAAGCCATGGCATGGGATGAACCAAATGCAAGTTGTGGGCGCAGTTGGCTTCCAGGACCGACGGCTTGACATTCCAAAAGAAGTAGATCCTATAGTTGCATCAATTATACGTGATTGCTGGCAGAAGGATCCAAACTTGCGTCCTTCTTTCATCCAATTAACTAGCTACCTGAAGACATTGCAAAGGCTTGTAATCCCTTCACATCAGGAGACAGCGAGCAACCATGTACCCTATGAAATATCTTTATATCGGTGA


Protein sequences

Name Description Sequence
EDR1 EDR1 [Triticum aestivum].

MKIPFVTKWSHRSSEPAGPSNSAAAQQQQQQQAPSPPPPVASTEAAGDEFILQEEEYQMQLALALSASASGAEGAGDPDGEQIRKAKLMSLGKGHPVTNSDRGGGDTPESLSRRYRDYNFLDYNEKVIDGFYDVFGLSAGSSGQGKIPSLAELQMSIGDLGYEVIVVDYKFDNALQEMKEVAECCLLGCPDITVLVRRIAEVVADHMGGPVIDANEMITRWLSKSIEQRTSHQTSLLHIGSIEIGLSRHRALLFKILADIVGIPCKLVKGSHYTGVEDDAINIIKMDDKREFLVDVMAAPGTLIPADVFNSKGTPFNFSQTLGQNQVVESASNIEDDPVALQSEHKRNQGHMFANNNRISVNLSSYENTMTAGSSASEPGTLDPRMQLGKTSTLPSAPSKQKKNLQLITDSHETEESRKLFVELDPFNAIESGKSSLAFKGLNNRNNEFQRRRENVVPPSVRSQQPLVMKNWSACNDISNNKQYNVADGSVPRRNATDNASSSQLALSTAKHYNSNVRELNDRVYAAPARNYDNKIVGTSAMAKALTGECPDRSQVPPGLYYDKMLGTSSMNAASTSGIGKVAEKDPHNDPGKGPIYSRFDGELSKNAQGFTPERDEHKENCGSHDHKMLYPDPRKSPLDRFMDRPRQSIECVFPSQVGSNKADMVLDEVSECEILWEDLVIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMGAVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETASNHVPYEISLYR

Domains

Domain Start-End Description Sequence

HMMPfam: PF14381
107-305 EDR1,Ethylene-responsive protein kinase Le-CTR1

TPESLSRRYRDYNFLDYNEKVIDGFYDVFGLSAGSSGQGKIPSLAELQMSIGDLGYEVIVVDYKFDNALQEMKEVAECCLLGCPDITVLVRRIAEVVADHMGGPVIDANEMITRWLSKSIEQRTSHQTSLLHIGSIEIGLSRHRALLFKILADIVGIPCKLVKGSHYTGVEDDAINIIKMDDKREFLVDVMAAPGTLIP

HMMPanther: PTHR23257
211-937 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VIDANEMITRWLSKSIEQRTSHQTSLLHIGSIEIGLSRHRALLFKILADIVGIPCKLVKGSHYTGVEDDAINIIKMDDKREFLVDVMAAPGTLIPADVFNSKGTPFNFSQTLGQNQVVESASNIEDDPVALQSEHKRNQGHMFANNNRISVNLSSYENTMTAGSSASEPGTLDPRMQLGKTSTLPSAPSKQKKNLQLITDSHETEESRKLFVELDPFNAIESGKSSLAFKGLNNRNNEFQRRRENVVPPSVRSQQPLVMKNWSACNDISNNKQYNVADGSVPRRNATDNASSSQLALSTAKHYNSNVRELNDRVYAAPARNYDNKIVGTSAMAKALTGECPDRSQVPPGLYYDKMLGTSSMNAASTSGIGKVAEKDPHNDPGKGPIYSRFDGELSKNAQGFTPERDEHKENCGSHDHKMLYPDPRKSPLDRFMDRPRQSIECVFPSQVGSNKADMVLDEVSECEILWEDLVIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMGAVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSYLKTLQR

HMMPanther: PTHR23257:SF80
211-937 PTHR23257:SF80,MAP3K DELTA-1 PROTEIN KINASE

VIDANEMITRWLSKSIEQRTSHQTSLLHIGSIEIGLSRHRALLFKILADIVGIPCKLVKGSHYTGVEDDAINIIKMDDKREFLVDVMAAPGTLIPADVFNSKGTPFNFSQTLGQNQVVESASNIEDDPVALQSEHKRNQGHMFANNNRISVNLSSYENTMTAGSSASEPGTLDPRMQLGKTSTLPSAPSKQKKNLQLITDSHETEESRKLFVELDPFNAIESGKSSLAFKGLNNRNNEFQRRRENVVPPSVRSQQPLVMKNWSACNDISNNKQYNVADGSVPRRNATDNASSSQLALSTAKHYNSNVRELNDRVYAAPARNYDNKIVGTSAMAKALTGECPDRSQVPPGLYYDKMLGTSSMNAASTSGIGKVAEKDPHNDPGKGPIYSRFDGELSKNAQGFTPERDEHKENCGSHDHKMLYPDPRKSPLDRFMDRPRQSIECVFPSQVGSNKADMVLDEVSECEILWEDLVIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMGAVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSYLKTLQR

superfamily: SSF56112
IPR011009
669-959 Kinase_like
Protein kinase-like domain

EVSECEILWEDLVIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMGAVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETASNHVPYEISLYR

Gene3D: G3DSA:3.30.200.20
673-742 G3DSA:3.30.200.20

CEILWEDLVIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMG

ProfileScan: PS50011
IPR000719
680-932 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LVIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMGAVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSYL

HMMPfam: PF07714
IPR001245
681-931 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

VIDERIGIGSYGEVYHADWNGTEVAVKKFLDQEFYGDALEEFRCEVRIMRRLRHPNIVLFMGAVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSY

PatternScan: PS00107
IPR017441
686-708 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGIGSYGEVYHADWNGTEVAVKK

Gene3D: G3DSA:1.10.510.10
743-928 G3DSA:1.10.510.10

AVTRPPHLSIVSEYLPRGSLYKIIHRPNCQIDEKRRIKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKSTAGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLDIPKEVDPIVASIIRDCWQKDPNLRPSFIQL

FPrintScan: PR00109
IPR001245
754-767 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

SEYLPRGSLYKIIH

FPrintScan: PR00109
IPR001245
793-811 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

HTSVPTIVHRDLKSPNLLV

PatternScan: PS00108
IPR008271
799-811 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSPNLLV

FPrintScan: PR00109
IPR001245
840-850 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

GTPEWMAPEVL

FPrintScan: PR00109
IPR001245
859-881 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CDIYSFGVILWELATLRKPWHGM

FPrintScan: PR00109
IPR001245
903-925 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

VDPIVASIIRDCWQKDPNLRPSF


List of References

Ji-Shan Niu, Li-Na Zhang, De-Feng Hong, Ying-Hong Wang
Cloning, characterization and expression of wheat EDR1 (enhanced disease resistance) gene.
Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao: 2005, 31(5);477-84
PubMed:16222089 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox